TGFBR2 Antibody / TGF beta Receptor II

Contact us
NSJ Bioreagents
Product Code: NSJ-RQ6531
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-RQ6531-100ug100ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Mouse
Antibody Isotype: Mouse IgG2b
Antibody Clonality: Monoclonal
Antibody Clone: 2F11
Regulatory Status: RUO
Target Species: Human
Applications:
  • Fluorescence-activated cell sorting (FACS)
  • Immunofluorescence (IF)
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
After reconstitution, the TGF beta Receptor II antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Images

1 / 6
Immunofluorescent staining of FFPE human HepG2 cells with TGF beta Receptor II antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
2 / 6
IHC staining of FFPE human cervical intraepithelial neoplasia tissue with TGF beta Receptor II antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
3 / 6
IHC staining of FFPE human placental tissue with TGF beta Receptor II antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
4 / 6
IHC staining of FFPE human esophageal squamous carcinoma tissue with TGF beta Receptor II antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
5 / 6
Western blot testing of human 1) HepG2, 2) A549, 3) K562, 4) Caco-2, 5) HeLa and 6) T-47D cell lysate with TGF beta Receptor II antibody. Expected molecular weight ~65 kDa, routinely observed at 65-80 kDa.
6 / 6
Flow cytometry testing of human A549 cells with TGF beta Receptor II antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= TGF beta Receptor II antibody.
❮❯

Immunofluorescent staining of FFPE human HepG2 cells with TGF beta Receptor II antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
IHC staining of FFPE human cervical intraepithelial neoplasia tissue with TGF beta Receptor II antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human placental tissue with TGF beta Receptor II antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human esophageal squamous carcinoma tissue with TGF beta Receptor II antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
Western blot testing of human 1) HepG2, 2) A549, 3) K562, 4) Caco-2, 5) HeLa and 6) T-47D cell lysate with TGF beta Receptor II antibody. Expected molecular weight ~65 kDa, routinely observed at 65-80 kDa.
Flow cytometry testing of human A549 cells with TGF beta Receptor II antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= TGF beta Receptor II antibody.

Documents

Further Information

Application Details :
Western blot: 1-2ug/ml,Immunohistochemistry (FFPE): 2-5ug/ml,Immunofluorescence: 5ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the TGF beta Receptor II antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose
Description:
TGFBR2 (transforming growth factor, beta receptor II (70/80kDa)), also known as TGF-beta receptor type-2, TGFR-2, TGF-beta type II receptor, Transforming growth factor-beta receptor type II (TGF-beta receptor type II, TbetaR-II), is a member of the Ser/Thr protein kinase family and the TGFB receptor subfamily. A TGFBR2 cDNA encodes a deduced 565-amino acid protein with a calculated molecular mass of approximately 60 kD in length. The encoded protein is a transmembrane protein that has a protein kinase domain, forms a heterodimeric complex with another receptor protein, and binds TGF-beta. This receptor/ligand complex phosphorylates proteins, which then enter the nucleus and regulate the transcription of a subset of genes related to cell proliferation. Mutations in this gene have been associated with Marfan syndrome, Loeys-Deitz aortic aneurysm syndrome, Osler-Weber-Rendu syndrome, and the development of various types of tumors. Alternatively spliced transcript variants encoding different informs have been characterized.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids 96-128 (TLETVCHDPKLPYHDFILEDAASPKCIMKEKKK) were used as the immunogen for the TGF beta Receptor II antibody.
Limitation:
This TGF beta Receptor II antibody is available for research use only.
Purity:
Affinity purified
Species Reactivity :
Human
Uniprot #:
P37173