HSP90 alpha Antibody / HSP90AA1

Contact us
NSJ Bioreagents
Product Code: NSJ-RQ6535
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-RQ6535-100ug100ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Mouse
Antibody Isotype: Mouse IgG2b
Antibody Clonality: Monoclonal
Antibody Clone: 6B5
Regulatory Status: RUO
Target Species:
  • Human
  • Monkey
  • Mouse
  • Rat
Applications:
  • Fluorescence-activated cell sorting (FACS)
  • Immunofluorescence (IF)
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
After reconstitution, the HSP90AA1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Images

1 / 7
Immunofluorescent staining of FFPE human SiHa cells with HSP90AA1 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
2 / 7
IHC staining of FFPE human colon cancer tissue with HSP90AA1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
3 / 7
IHC staining of FFPE human cervical cancer tissue with HSP90AA1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
4 / 7
IHC staining of FFPE human lung cancer tissue with HSP90AA1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
5 / 7
IHC staining of FFPE human testis cancer tissue with HSP90AA1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
6 / 7
Western blot testing of 1) human HeLa, 2) human HEK293, 3) monkey COS-7, 4) human HepG2, 5) human A549, 6) rat PC-3, 7) rat RH35 and 8) mouse HEPA1-6 cell lysate with HSP90AA1 antibody. Expected molecular weight: 86~90 kDa.
7 / 7
Flow cytometry testing of human A549 cells with HSP90AA1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= HSP90AA1 antibody.
❮❯

Immunofluorescent staining of FFPE human SiHa cells with HSP90AA1 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
IHC staining of FFPE human colon cancer tissue with HSP90AA1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human cervical cancer tissue with HSP90AA1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human lung cancer tissue with HSP90AA1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human testis cancer tissue with HSP90AA1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
Western blot testing of 1) human HeLa, 2) human HEK293, 3) monkey COS-7, 4) human HepG2, 5) human A549, 6) rat PC-3, 7) rat RH35 and 8) mouse HEPA1-6 cell lysate with HSP90AA1 antibody. Expected molecular weight: 86~90 kDa.
Flow cytometry testing of human A549 cells with HSP90AA1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= HSP90AA1 antibody.

Documents

Further Information

Application Details :
Western blot: 1-2ug/ml,Immunohistochemistry (FFPE): 2-5ug/ml,Immunofluorescence: 5ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the HSP90AA1 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose
Description:
Heat shock protein HSP 90-alpha is a protein that in humans is encoded by the HSP90AA1 gene. This gene encodes the human stress-inducible 90-kDa heat shock protein alpha (Hsp90A). Complemented by the constitutively expressed paralog Hsp90B which shares over 85% amino acid sequence identity, Hsp90A expression is initiated when a cell experiences proteotoxic stress. Once expressed Hsp90A dimers operate as molecular chaperones that bind and fold other proteins into their functional 3-dimensional structures. This molecular chaperoning ability of Hsp90A is driven by a cycle of structural rearrangements fueled by ATP hydrolysis. Current research on Hsp90A focuses in its role as a drug target due to its interaction with a large number of tumor promoting proteins and its role in cellular stress adaptation.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids 454-488 (QNRKKLSELLRYYTSASGDEMVSLKDYCTRMKENQ) from the human protein were used as the immunogen for the HSP90AA1 antibody.
Limitation:
This HSP90AA1 antibody is available for research use only.
Localization:
Cell membrane, cytoplasmic, nuclear
Purity:
Affinity purified
Species Reactivity :
Human, Mouse, Rat, Monkey
Uniprot #:
P07900