Recombinant Mouse IFN beta 1a protein(N-His)(active)
Code | Size | Price |
---|
PKSM041493-20ug | 20ug | £210.00 |
Quantity:
PKSM041493-100ug | 100ug | £472.00 |
Quantity:
Prices exclude any Taxes / VAT
Overview
Host Type: Mouse
Regulatory Status: RUO
Application: Cell Culture
Shipping:
This product is provided as lyophilized powder which is shipped with ice packs.
Storage:
Generally lyophilized proteins are stable for up to 12 months when stored at -20 to -80°C. Reconstituted protein solution can be stored at 4-8°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Images
Further Information
Abbreviation:
IFN beta 1a
Accession:
P01575
Activity:
Measure by its ability to protect HeLa cells infected with encephalomyocarditis (EMC) virus. The ED50 for this effect is < 5 pg/mL. The specific activity of recombinant mouse IFN beta 1a is > 1 x 109IU/mg.
Background:
Interferons (IFNs) are natural glycoproteins belonging to the cytokine superfamily and are produced by the cells of the immune system of most vertebrates in response to challenges by foreign agents such as viruses, parasites, and tumor cells. Interferon-beta (IFN beta) is an extracellular protein mediator of host defense and homeostasis. IFN beta has well-established direct antiviral, antiproliferative, and immunomodulatory properties. Recombinant IFN beta is approved for the treatment of relapsing-remitting multiple sclerosis. The recombinant IFN beta protein has the theoretical potential to either treat or causes autoimmune neuromuscular disorders by altering the complicated and delicate balances within the immune system networks. It is the most widely prescribed disease-modifying therapy for multiple sclerosis (MS). IFN beta is effective in reducing relapses in secondary progressive MS and may have a modest effect in slowing disability progression. In addition to the common antiviral activity, IFN beta also induces increased production of the p53 gene product which promotes apoptosis and thus has a therapeutic effect against certain cancers. The role of IFN-beta in bone metabolism could warrant its systematic evaluation as a potential adjunct to therapeutic regimens of osteolytic diseases. Furthermore, IFN beta might play a beneficial role in the development of chronic progressive CNS inflammation.
Calculated MW:
22.95 kDa
Endotoxin:
< 0.1 EU per ug of the protein as determined by the LAL method.
Expression Host:
E.coli
Formulation:
Lyophilized from sterile PBS, pH 7.4
Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.
Please refer to the specific buffer information in the printed manual.
Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.
Please refer to the specific buffer information in the printed manual.
Fusion tag:
N-His
Purity:
> 98 % as determined by reducing SDS-PAGE.
Sequence:
MNNRWILHAAFLLCFSTTALSINYKQLQLQERTNIRKCQELLEQLNGKINLTYRADFKIPMEMTEKMQKSYTAFAIQEMLQNVFLVFRNNFSSTGWNETIVVRLLDELHQQTVFLKTVLEEKQEERLTWEMSSTALHLKSYYWRVQRYLKLMKYNSYAWMVVRAEIFRNFLIIRRLTRNFQN
Target Synonym:
interleukin 1 family;member 10;IL1F10
UNIProt ID:
P01575