Recombinant Mouse Flt-3 Ligand protein(N-His)(active)
| Code | Size | Price |
|---|
| PKSM041496-20ug | 20ug | £210.00 |
Quantity:
| PKSM041496-100ug | 100ug | £472.00 |
Quantity:
Prices exclude any Taxes / VAT
Overview
Host Type: Mouse
Regulatory Status: RUO
Application: Cell Culture
Shipping:
This product is provided as lyophilized powder which is shipped with ice packs.
Storage:
Generally lyophilized proteins are stable for up to 12 months when stored at -20 to -80°C. Reconstituted protein solution can be stored at 4-8°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Further Information
Abbreviation:
Flt-3 Ligand
Accession:
P49772
Activity:
Measure by its ability to induce proliferation in BaF3 cells transfected with mouse Flt-3. The ED50 for this effect is < 2 ng/mL.
Background:
The cluster of differentiation (CD) system is commonly used as cell markers in immunophynotyping. Different kinds of cells in the immune system can be identified through the surface CD molecules which associating with the immune function of the cell. There are more than 320 CD unique clusters and subclusters have been identified. Some of the CD molecules serve as receptors or ligands important to the cell through initiating a signal cascade which then alter the behavior of the cell. Some CD proteins do not take part in cell signal process but have other functions such as cell adhesion. CD135, also known as FLT-3, FLK-2, is a member of the CD system. CD135 is an important cell surface marker recognized by specific sets of antibodies to identify the types of hematopoietic (blood) progenitors in the bone marrow and it function to differentiate hematopoietic stem cells, which are CD135 negative, from multipotent progenitors, which are CD135 positive. CD135 is a receptor tyrosine kinase type III for the cytokine Flt3 ligand and activat signaling through second messengers by binding to Flt3. Signaling through CD135 is important for lymphocyte development. The encoding gene CD135 is a proto-oncogene to which mutations happened will lead to cancer such as leukemia.
Calculated MW:
26.97 kDa
Endotoxin:
< 0.1 EU per ug of the protein as determined by the LAL method.
Expression Host:
E.coli
Formulation:
Lyophilized from sterile PBS, pH 7.4
Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.
Please refer to the specific buffer information in the printed manual.
Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.
Please refer to the specific buffer information in the printed manual.
Fusion tag:
N-His
Purity:
> 98 % as determined by reducing SDS-PAGE.
Sequence:
MTVLAPAWSPNSSLLLLLLLLSPCLRGTPDCYFSHSPISSNFKVKFRELTDHLLKDYPVTVAVNLQDEKHCKALWSLFLAQRWIEQLKTVAGSKMQTLLEDVNTEIHFVTSCTFQPLPECLRFVQTNISHLLKDTCTQLLALKPCIGKACQNFSRCLEVQCQPDSSTLLPPRSPIALEATELPEPRPRQLLLLLLLLLPLTLVLLAAAWGLRWQRARRRGELHPGVPLPSHP
Target Synonym:
soluble Fas Ligand (sFasL);TNFSF6;CD95L;Apo I Ligand;APTL;APT1LG1;CD178;Fas-Lg;Tnfs;Tnlg1a;gld
UNIProt ID:
P49772