GDF9 Antibody / Growth Differentiation Factor 9

NSJ Bioreagents
Product Code: NSJ-V8671SAF
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-V8671SAF-100UG100 ug£534.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Mouse
Antibody Isotype: Mouse IgG1
Antibody Clonality: Monoclonal
Antibody Clone: GDF9/4261
Regulatory Status: RUO
Target Species: Human
Applications:
  • Enzyme-Linked Immunosorbent Assay (ELISA)
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
Store the GDF9 antibody at 2-8oC (with azide) or aliquot and store at -20oC or colder (without azide).

Images

1 / 2
IHC staining of FFPE human ovary with GDF9 antibody. HIER: boil tissue sections in pH 9 10mM Tris with 1mM EDTA for 20 min and allow to cool before testing.~
2 / 2
SDS-PAGE analysis of purified, BSA-free GDF9 antibody as confirmation of integr

IHC staining of FFPE human ovary with GDF9 antibody. HIER: boil tissue sections in pH 9 10mM Tris with 1mM EDTA for 20 min and allow to cool before testing.~
SDS-PAGE analysis of purified, BSA-free GDF9 antibody as confirmation of integr

Documents

Further Information

Application Details:
ELISA: order Ab without BSA for coating,Western blot: 1-2ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml for 30 minutes at RT
Application Note:
Optimal dilution of the GDF9 antibody should be determined by the researcher.
Description:
GDF9 is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. Growth factors synthesized by ovarian somatic cells directly affect oocyte growth and function. GDF9 is expressed in oocytes and is thought to be required for ovarian folliculogenesis. GDF9/4261 can be used in assays to detect oocyte expression and has been shown to neutralize GDF9 biological activity.
Format:
Purified
Formulation:
1 mg/ml in 1X PBS; BSA free, sodium azide free
Immunogen:
Amino acids VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC from the C-terminal region of human GDF9 were used as the immunogen for the GDF9 antibody. The epitope has been mapped to amino acids EPDG.
Limitation:
This GDF9 antibody is available for research use only.
Localization:
Cytoplasmic (secreted)
Purity:
Protein G affinity chromatography
Uniprot #:
O60383