POR Antibody / CYPOR / Cytochrome P450 Oxidoreductase (Antigen affinity purified)

Contact us
NSJ Bioreagents
Product Code: NSJ-RQ6592
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-RQ6592-100ug100ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Mouse
Antibody Isotype: Mouse IgG2b
Antibody Clonality: Monoclonal
Antibody Clone: 7F5
Regulatory Status: RUO
Target Species: Human
Applications:
  • Fluorescence-activated cell sorting (FACS)
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
After reconstitution, the Cytochrome P450 Reductase antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Images

1 / 6
IHC staining of FFPE human esophageal squamous carcinoma tissue with Cytochrome P450 Reductase antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
2 / 6
IHC staining of FFPE human liver cancer tissue with Cytochrome P450 Reductase antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
3 / 6
IHC staining of FFPE human lung cancer tissue with Cytochrome P450 Reductase antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
4 / 6
IHC staining of FFPE human placental tissue with Cytochrome P450 Reductase antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
5 / 6
Western blot testing of human 1) HepG2 and 2) A549 cell lysate with Cytochrome P450 Reductase antibody. Predicted molecular weight: ~77 kDa.
6 / 6
Flow cytometry testing of human SiHa cells with Cytochrome P450 Reductase antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= Cytochrome P450 Reductase antibody.
❮❯

IHC staining of FFPE human esophageal squamous carcinoma tissue with Cytochrome P450 Reductase antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human liver cancer tissue with Cytochrome P450 Reductase antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human lung cancer tissue with Cytochrome P450 Reductase antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human placental tissue with Cytochrome P450 Reductase antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
Western blot testing of human 1) HepG2 and 2) A549 cell lysate with Cytochrome P450 Reductase antibody. Predicted molecular weight: ~77 kDa.
Flow cytometry testing of human SiHa cells with Cytochrome P450 Reductase antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= Cytochrome P450 Reductase antibody.

Documents

Further Information

Application Details:
Western blot: 1-2ug/ml,Immunohistochemistry (FFPE): 2-5ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the Cytochrome P450 Reductase antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose
Description:
POR is a membrane-bound enzyme required for electron transfer from NADPH to cytochrome P450 in the endoplasmic reticulum of the eukaryotic cell. The gene encodes an endoplasmic reticulum membrane oxidoreductase with an FAD-binding domain and a flavodoxin-like domain. The protein binds two cofactors, FAD and FMN, which allow it to donate electrons directly from NADPH to all microsomal P450 enzymes. Mutations in this gene have been associated with various diseases, including apparent combined P450C17 and P450C21 deficiency, amenorrhea and disordered steroidogenesis, congenital adrenal hyperplasia and Antley-Bixler syndrome.
Format:
Antigen affinity purified
Formulation:
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
C-terminal region amino acids RNMARDVQNTFYDIVAELGAMEHAQAVDYIKKLMTK from the human protein were used as the immunogen for the Cytochrome P450 Reductase antibody.
Limitation:
This Cytochrome P450 Reductase antibody is available for research use only.
Localization:
Cytoplasmic, cell membrane
Purity:
Antigen affinity purified
Uniprot #:
P16435