DHODH Antibody (Antigen affinity purified)

Contact us
NSJ Bioreagents
Product Code: NSJ-RQ6735
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-RQ6735-100ug100ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
After reconstitution, the Dihydroorotate dehydrogenase antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Images

1 / 6
IHC staining of FFPE human breast cancer tissue with Dihydroorotate dehydrogenase antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
2 / 6
IHC staining of FFPE human liver cancer tissue with Dihydroorotate dehydrogenase antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
3 / 6
IHC staining of FFPE human renal carcinoma tissue with Dihydroorotate dehydrogenase antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
4 / 6
IHC staining of FFPE human gastric cancer tissue with Dihydroorotate dehydrogenase antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
5 / 6
IHC staining of FFPE human placental tissue with Dihydroorotate dehydrogenase antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
6 / 6
Western blot testing of 1) human HeLa, 2) human A431, 3) human HepG2, 4) human MCF7, 5) rat testis, 6) rat liver, 7) mouse testis and 8) mouse liver tissue lysate with Dihydroorotate dehydrogenase antibody. Predicted molecular weight ~43 kDa.
❮❯

IHC staining of FFPE human breast cancer tissue with Dihydroorotate dehydrogenase antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human liver cancer tissue with Dihydroorotate dehydrogenase antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human renal carcinoma tissue with Dihydroorotate dehydrogenase antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human gastric cancer tissue with Dihydroorotate dehydrogenase antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human placental tissue with Dihydroorotate dehydrogenase antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
Western blot testing of 1) human HeLa, 2) human A431, 3) human HepG2, 4) human MCF7, 5) rat testis, 6) rat liver, 7) mouse testis and 8) mouse liver tissue lysate with Dihydroorotate dehydrogenase antibody. Predicted molecular weight ~43 kDa.

Documents

Further Information

Application Details:
Western blot: 1-2ug/ml,Immunohistochemistry (FFPE): 2-5ug/ml
Application Note:
Optimal dilution of the Dihydroorotate dehydrogenase antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose
Description:
Dihydroorotate dehydrogenase (DHODH) is an enzyme that in humans is encoded by the DHODH gene on chromosome 16. The protein encoded by this gene catalyzes the fourth enzymatic step, the ubiquinone-mediated oxidation of dihydroorotate to orotate, in de novo pyrimidine biosynthesis. This protein is a mitochondrial protein located on the outer surface of the inner mitochondrial membrane.
Format:
Antigen affinity purified
Formulation:
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
N-terminal region amino acids RVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTE D from the human protein were used as the immunogen for the Dihydroorotate dehydrogenase antibody.
Limitation:
This Dihydroorotate dehydrogenase antibody is available for research use only.
Localization:
Cytoplasmic, nuclear
Purity:
Affinity purified
Uniprot #:
Q02127