MYH6 Antibody / Myosin 6 (Antigen affinity purified)

NSJ Bioreagents
Product Code: NSJ-RQ6780
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-RQ6780-100ug100ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Fluorescence-activated cell sorting (FACS)
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
After reconstitution, the Myosin 6 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Images

1 / 5
IHC staining of FFPE human heart tissue with Myosin 6 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
2 / 5
IHC staining of FFPE mouse heart tissue with Myosin 6 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
3 / 5
IHC staining of FFPE rat heart tissue with Myosin 6 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
4 / 5
Western blot testing of mouse heart tissue with Myosin 6 antibody. Predicted molecular weight ~224 kDa, routinely observed at 200-250 kDa.
5 / 5
Flow cytometry testing of human U937 cells with Myosin 6 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= Myosin 6 antibody.

IHC staining of FFPE human heart tissue with Myosin 6 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE mouse heart tissue with Myosin 6 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE rat heart tissue with Myosin 6 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
Western blot testing of mouse heart tissue with Myosin 6 antibody. Predicted molecular weight ~224 kDa, routinely observed at 200-250 kDa.
Flow cytometry testing of human U937 cells with Myosin 6 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= Myosin 6 antibody.

Documents

Further Information

Application Details:
Western blot: 1-2ug/ml,Immunohistochemistry (FFPE): 2-5ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the Myosin 6 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose
Description:
Myosin heavy chain, alpha isoform (MHC-alpha) is a protein that in humans is encoded by the MYH6 gene. Cardiac muscle myosin is a hexamer consisting of two heavy chain subunits, two light chain subunits, and two regulatory subunits. This gene encodes the alpha heavy chain subunit of cardiac myosin. The gene is located approximately 4kb downstream of the gene encoding the beta heavy chain subunit of cardiac myosin. Mutations in this gene cause familial hypertrophic cardiomyopathy and atrial septal defect 3.
Format:
Antigen affinity purified
Formulation:
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids RTLEDQANEYRVKLEEAQRSLNDFTTQRAKLQ from the human protein were used as the immunogen for the Myosin 6 antibody.
Limitation:
This Myosin 6 antibody is available for research use only.
Localization:
Cytoplasmic
Purity:
Antigen affinity purified
Uniprot #:
P13533