MLX Antibody / Max-like protein X (Antigen affinity purified)

NSJ Bioreagents
Product Code: NSJ-RQ6889
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-RQ6889-100ug100ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Human
  • Monkey
  • Mouse
Applications:
  • Fluorescence-activated cell sorting (FACS)
  • Western Blot (WB)
Storage:
After reconstitution, the MLX antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Images

1 / 2
Flow cytometry testing of human ThP-1 cells with MLX antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= MLX antibody.~
2 / 2
Western blot testing of 1) human HepG2, 2) human MCF7, 3) human SiHa, 4) monk

Flow cytometry testing of human ThP-1 cells with MLX antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= MLX antibody.~
Western blot testing of 1) human HepG2, 2) human MCF7, 3) human SiHa, 4) monk

Documents

Further Information

Application Details:
Western blot: 1-2ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the MLX antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose
Description:
Max-like protein X is a protein that in humans is encoded by the MLX gene. The product of this gene belongs to the family of basic helix-loop-helix leucine zipper (bHLH-Zip) transcription factors. These factors form heterodimers with Mad proteins and play a role in proliferation, determination and differentiation. This gene product may act to diversify Mad family function by its restricted association with a subset of the Mad family of transcriptional repressors, namely, Mad1 and Mad4. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene.
Format:
Antigen affinity purified
Formulation:
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids FQELSACVFSWIEEHCKPQTLREIVIGVLHQLKNQLY from the human protein were used as the immunogen for the MLX antibody.
Limitation:
This MLX antibody is available for research use only.
Purity:
Antigen affinity purified
Uniprot #:
Q9UH92