Superoxide Dismutase 2 Antibody / SOD2 [Clone 2B12B1] (Antigen affinity purified)

Contact us
NSJ Bioreagents
Product Code: NSJ-RQ7037
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-RQ7037-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Mouse
Antibody Isotype: Mouse IgG2b
Antibody Clonality: Monoclonal
Antibody Clone: 2B12B1
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
After reconstitution, the Superoxide Dismutase 2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Images

1 / 4
IHC staining of FFPE human liver cancer tissue with Superoxide Dismutase 2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
2 / 4
IHC staining of FFPE human adenocarcinoma of the right colon tissue with Superoxide Dismutase 2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
3 / 4
IHC staining of FFPE human lymphoma tissue with Superoxide Dismutase 2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
4 / 4
Western blot testing of 1) human HepG2, 2) human HCCT, 3) human HCCP, 4) mouse liver and 5) mouse heart tissue lysate with Superoxide Dismutase 2 antibody. Predicted molecular weight ~25 kDa.
❮❯

IHC staining of FFPE human liver cancer tissue with Superoxide Dismutase 2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human adenocarcinoma of the right colon tissue with Superoxide Dismutase 2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human lymphoma tissue with Superoxide Dismutase 2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
Western blot testing of 1) human HepG2, 2) human HCCT, 3) human HCCP, 4) mouse liver and 5) mouse heart tissue lysate with Superoxide Dismutase 2 antibody. Predicted molecular weight ~25 kDa.

Documents

Further Information

Application Details:
Western blot: 0.5-1 ug/ml,Immunohistochemistry (FFPE): 2-5ug/ml
Application Note:
Optimal dilution of the Superoxide Dismutase 2 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose
Description:
SOD2 (Superoxide Dismutase 2), also called IPO-B or MNSOD, is a mitochondrial matrix enzyme that scavenges oxygen radicals produced by the extensive oxidation-reduction and electron transport reactions occurring in mitochondria. This gene is a member of the iron/manganese superoxide dismutase family. Using a somatic cell hybrid panel containing different segments of chromosome 6, they demonstrated that SOD2 is located in the region 6q25.3-qter which, together with the FISH analysis, indicated that SOD2 is in the distal portion of 6q25. The SOD2 gene encodes an intramitochondrial free radical scavenging enzyme that is the first line of defense against superoxide produced as a byproduct of oxidative phosphorylation. Adeno-associated viral delivery of the human SOD2 gene resulted in suppression of optic nerve degeneration and rescue of retinal ganglion cells. The findings suggested that reactive oxygen species contributed to retinal cell death and optic nerve damage in mice with complex I deficiency, and that expression of SOD2 attenuated the disease process.
Format:
Antigen affinity purified
Formulation:
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
C-terminal amino acids QYKNVRPDYLKAIWNVINWENVTERYMACKK were used as the immunogen for the Superoxide Dismutase 2 antibody.
Limitation:
This Superoxide Dismutase 2 antibody is available for research use only.
Localization:
Cytoplasmic
Purity:
Antigen affinity purified
Uniprot #:
P04179