TPR Antibody / Translocated promoter region protein (Antigen affinity purified)

Contact us
NSJ Bioreagents
Product Code: NSJ-RQ7045
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-RQ7045-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Fluorescence-activated cell sorting (FACS)
  • Immunofluorescence (IF)
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
After reconstitution, the TPR antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Images

1 / 7
Immunofluorescent staining of FFPE human Caco-2 cells with TPR antibody. HIER: steam section in pH6 citrate buffer for 20 min.
2 / 7
Immunofluorescent staining of FFPE human SiHa cells with TPR antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
3 / 7
IHC staining of FFPE human colorectal cancer tissue with TPR antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
4 / 7
IHC staining of FFPE mouse brain tissue with TPR antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
5 / 7
IHC staining of FFPE rat brain tissue with TPR antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
6 / 7
Western blot testing of human 1) K562, 2) HL60, 3) HEL, 4) HeLa, 5) U-251 and 6) SiHa cell lysate with TPR antibody. Predicted molecular weight ~267 kDa.
7 / 7
Flow cytometry testing of human Jurkat cells with TPR antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= TPR antibody.
❮❯

Immunofluorescent staining of FFPE human Caco-2 cells with TPR antibody. HIER: steam section in pH6 citrate buffer for 20 min.
Immunofluorescent staining of FFPE human SiHa cells with TPR antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
IHC staining of FFPE human colorectal cancer tissue with TPR antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE mouse brain tissue with TPR antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE rat brain tissue with TPR antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
Western blot testing of human 1) K562, 2) HL60, 3) HEL, 4) HeLa, 5) U-251 and 6) SiHa cell lysate with TPR antibody. Predicted molecular weight ~267 kDa.
Flow cytometry testing of human Jurkat cells with TPR antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= TPR antibody.

Documents

Further Information

Application Details:
Western blot: 0.5-1 ug/ml,Immunohistochemistry (FFPE): 2-5ug/ml,Immunofluorescence: 5ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the TPR antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose
Description:
The tetratricopeptide repeat (TPR) is a structural motif. This gene encodes a large coiled-coil protein that forms intranuclear filaments attached to the inner surface of nuclear pore complexes (NPCs). The protein directly interacts with several components of the NPC. It is required for the nuclear export of mRNAs and some proteins. Oncogenic fusions of the 5' end of this gene with several different kinase genes occur in some neoplasias.
Format:
Antigen affinity purified
Formulation:
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids AAVLQQVLERTELNKLPKSVQNKLEKFLADQQ were used as the immunogen for the TPR antibody.
Limitation:
This TPR antibody is available for research use only.
Localization:
Cytoplasmic, nuclear
Purity:
Antigen affinity purified
Uniprot #:
P12270