YY1 Antibody [Clone 6H3E1] (Antigen affinity purified)

Contact us
NSJ Bioreagents
Product Code: NSJ-RQ7049
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-RQ7049-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Mouse
Antibody Isotype: Mouse IgG2b
Antibody Clonality: Monoclonal
Antibody Clone: 6H3E1
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Fluorescence-activated cell sorting (FACS)
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
After reconstitution, the Yin and yang 1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Images

1 / 3
Flow cytometry testing of human PC-3 cells with Yin and yang 1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= Yin and yang 1 antibody.
2 / 3
Western blot testing of 1) human Caco-2, 2) human SW620, 3) human MDA-MB-453, 4) human PC-3, 5) rat thymus and 6) mouse thymus tissue lysate with Yin and yang 1 antibody. Predicted molecular weight ~45 kDa but commonly observed at 45~65 kDa.
3 / 3
IHC staining of FFPE human laryngeal squamous cell carcinoma tissue with Yin and yang 1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
❮❯

Flow cytometry testing of human PC-3 cells with Yin and yang 1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= Yin and yang 1 antibody.
Western blot testing of 1) human Caco-2, 2) human SW620, 3) human MDA-MB-453, 4) human PC-3, 5) rat thymus and 6) mouse thymus tissue lysate with Yin and yang 1 antibody. Predicted molecular weight ~45 kDa but commonly observed at 45~65 kDa.
IHC staining of FFPE human laryngeal squamous cell carcinoma tissue with Yin and yang 1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.

Documents

Further Information

Application Details:
Western blot: 0.5-1 ug/ml,Immunohistochemistry (FFPE): 2-5ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the Yin and yang 1 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose
Description:
YY1 (Yin Yang 1) is a transcriptional repressor protein in humans that is encoded by the YY1 gene. YY1 is a ubiquitously distributed transcription factor belonging to the GLI-Kruppel class of zinc finger proteins. The protein is involved in repressing and activating a diverse number of promoters. YY1 may direct histone deacetylases and histone acetyltransferases to a promoter in order to activate or repress the promoter, thus implicating histone modification in the function of YY1.
Format:
Antigen affinity purified
Formulation:
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids EQKQVQIKTLEGEFSVTMWSSDEKKDIDHETVVEEQ were used as the immunogen for the Yin and yang 1 antibody.
Limitation:
This Yin and yang 1 antibody is available for research use only.
Localization:
Nuclear
Purity:
Antigen affinity purified
Uniprot #:
P25490