CXCR7 Antibody

Contact us
NSJ Bioreagents
Product Code: NSJ-RQ7428
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-RQ7428-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species: Human
Applications:
  • Fluorescence-activated cell sorting (FACS)
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
After reconstitution, the CXCR7 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Images

1 / 7
IHC staining of FFPE human urothelial carcinoma tissue with CXCR7 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
2 / 7
IHC staining of FFPE human endometrial cancer tissue with CXCR7 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
3 / 7
IHC staining of FFPE human colon adenocarcinoma tissue with CXCR7 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
4 / 7
IHC staining of FFPE human breast cancer tissue with CXCR7 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
5 / 7
IHC staining of FFPE human tonsil tissue with CXCR7 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
6 / 7
Western blot testing of human 1) RT4 and 2) HeLa cell lysate with CXCR7 antibody. Predicted molecular weight ~43 kDa.
7 / 7
Flow cytometry testing of human SiHa cells with CXCR7 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= CXCR7 antibody.
❮❯

IHC staining of FFPE human urothelial carcinoma tissue with CXCR7 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human endometrial cancer tissue with CXCR7 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human colon adenocarcinoma tissue with CXCR7 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human breast cancer tissue with CXCR7 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human tonsil tissue with CXCR7 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
Western blot testing of human 1) RT4 and 2) HeLa cell lysate with CXCR7 antibody. Predicted molecular weight ~43 kDa.
Flow cytometry testing of human SiHa cells with CXCR7 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= CXCR7 antibody.

Documents

Further Information

Application Details:
Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 2-5ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the CXCR7 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose
Description:
Atypical chemokine receptor 3 also known as C-X-C chemokine receptor type 7 (CXCR-7) and G-protein coupled receptor 159 (GPR159) is a protein that in humans is encoded by the ACKR3 gene. This gene encodes a member of the G-protein coupled receptor family. Although this protein was earlier thought to be a receptor for vasoactive intestinal peptide (VIP), it is now considered to be an orphan receptor, in that its endogenous ligand has not been identified. The protein is also a coreceptor for human immunodeficiency viruses (HIV). Translocations involving this gene and HMGA2 on chromosome 12 have been observed in lipomas.
Format:
Antigen affinity purified
Formulation:
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids RNYRYELMKAFIFKYSAKTGLTKLIDASRVSE from the human protein were used as the immunogen for the CXCR7 antibody.
Limitation:
This CXCR7 antibody is available for research use only.
Localization:
Cell membrane, cytoplasm
Purity:
Antigen affinity purified
Uniprot #:
P25106