TNF alpha Antibody

Contact us
NSJ Bioreagents
Product Code: NSJ-R30264
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-R30264-100UG100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Fluorescence-activated cell sorting (FACS)
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
After reconstitution, the TNF alpha antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Images

1 / 3
IHC staining of FFPE human B lymphocytic tumor tissue with TNF alpha antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
2 / 3
Western blot testing of 1) human U937, 2) rat spleen, 3) rat C6 and 4) mouse spleen tissue lysate with TNF alpha antibody. Predicted molecular weight ~26 kDa.
3 / 3
Flow cytometry testing of human Caco-2 cells with TNF alpha antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= TNF alpha antibody.
❮❯

IHC staining of FFPE human B lymphocytic tumor tissue with TNF alpha antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
Western blot testing of 1) human U937, 2) rat spleen, 3) rat C6 and 4) mouse spleen tissue lysate with TNF alpha antibody. Predicted molecular weight ~26 kDa.
Flow cytometry testing of human Caco-2 cells with TNF alpha antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= TNF alpha antibody.

Documents

Further Information

Application Details:
Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 2-5ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
The stated application concentrations are suggested starting points. Titration of the TNF alpha antibody may be required due to differences in protocols and secondary/substrate sensitivity.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose
Description:
Tumor Necrosis Factor alpha is a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. This cytokine is mainly secreted by macrophages. It binds and functions through its receptors TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is involved in the regulation of a wide spectrum of biological processes including cell proliferation, differentiation, apoptosis, lipid metabolism, and coagulation and has been implicated in a variety of diseases, including autoimmune diseases, insulin resistance, and cancer. Knockout studies in mice also suggested the neuroprotective function of this cytokine.
Format:
Purified
Formulation:
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids 201-233 (QLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL) were used as the immunogen for this TNF alpha antibody.
Limitation:
This TNF alpha antibody is available for research use only.
Localization:
Cell membrane, secreted
Purity:
Antigen affinity
Uniprot #:
P01375