TCF-8 Antibody / ZEB1 / AREB6

Product Code: NSJ-RQ7307

Code	Size	Price

NSJ-RQ7307-100UG

100 ug

£535.00

Quantity:

Prices exclude any Taxes / VAT

Overview

Host Type: Mouse

Antibody Isotype: Mouse IgG2b

Antibody Clonality: Monoclonal

Antibody Clone: 8B12D1

Regulatory Status: RUO

Target Species:

Human
Mouse
Rat

Applications:

Immunohistochemistry- Paraffin Embedded (IHC-P)
Western Blot (WB)

Storage:

After reconstitution, the TCF-8 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Images

1 / 12

IHC staining of FFPE human testicular germ cell tumor tissue with TCF-8 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.

2 / 12

IHC staining of FFPE human thyroid cancer tissue with TCF-8 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.

3 / 12

IHC staining of FFPE human glioblastoma tissue with TCF-8 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.

4 / 12

IHC staining of FFPE human breast cancer tissue with TCF-8 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.

5 / 12

IHC staining of FFPE human laryngeal squamous cell carcinoma tissue with TCF-8 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.

6 / 12

IHC staining of FFPE human lung adenocarcinoma tissue with TCF-8 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.

7 / 12

IHC staining of FFPE human colorectal adenocarcinoma tissue with TCF-8 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.

8 / 12

IHC staining of FFPE mouse brain tissue with TCF-8 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.

9 / 12

IHC staining of FFPE rat brain tissue with TCF-8 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.

10 / 12

Immunofluorescent staining of FFPE human glioma tissue with TCF-8 antibody. HIER: steam section in pH8 EDTA buffer for 20 min.

11 / 12

Immunofluorescent staining of FFPE human U-87 MG cells with TCF-8 antibody. HIER: steam section in pH6 citrate buffer for 20 min.

12 / 12

Western blot testing of 1) human U-87 MG, 2) rat brain, 3) mouse brain and 4) mouse lung tissue lysate with TCF-8 antibody. Predicted molecular weight ~124 kDa but observed at up to ~200 kDa.

❮❯

Documents

Datasheet

Further Information

Application Details:

Western blot: 0.5-1ug/ml, Immunohistochemistry (FFPE): 2-5ug/ml

Application Note:

Optimal dilution of the TCF-8 antibody should be determined by the researcher.

Buffer:

Lyophilized from 1X PBS with 2% Trehalose

Description:

ZEB1 (Zinc Finger E Box-Binding Homeobox 1), also called TCF8, AREB6, NIL2A or DELTA-EF1, is a protein that in humans is encoded by the ZEB1 gene. Fluorescence in situ hybridization localized the ZEB1 gene to chromosome 10p11.2. Krafchak et al. (2005) demonstrated a complex (core plus secondary) binding site for TCF8 in the promoter of the COL4A3 gene, mutant in Alport syndrome and which encodes collagen type IV alpha-3. They detected expression of TCF8 in cornea. Nishimura et al. (2006) found that delta-Ef1 was upregulated during differentiation in a mouse smooth muscle cell (SMC) line.

Format:

Antigen affinity purified

Formulation:

0.5mg/ml if reconstituted with 0.2ml sterile DI water

Immunogen:

Amino acids LLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQ were used as the immunogen for the TCF-8 antibody.

Limitation:

This TCF-8 antibody is available for research use only.

Localization:

Nuclear

Purity:

Antigen affinity purified

Uniprot #:

P37275