Mouse anti Integrin alpha 3A

Nordic MuBio
Product Code: MUB0900P
Product Group: Primary Antibodies
Supplier: Nordic MuBio
CodeSizePrice
MUB0900P0.1 mg£326.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Mouse
Antibody Isotype: IgG1
Antibody Clonality: Monoclonal
Antibody Clone: 29A3
Regulatory Status: RUO
Target Species: Human
Applications:
  • Immunocytochemistry (ICC)
  • Immunohistochemistry (IHC)
  • Western Blot (WB)
Storage:
Store at 4°C or in small aliquots at -20°C.

Images

1 / 1

Further Information

Applications Description:
29A3 is suitable for immunoblotting, immunocytochemistry and immunohistochemistry on frozen tissues. Optimal antibody dilution should be determined by titration; recommended range is 1:100 ? 1:200 for immunohistochemistry with avidin-biotinylated Horseradish peroxidase complex (ABC) as detection reagent, and 1:100 ? 1:1000 for immunoblotting applications.
Background:
Integrins are a family of heterodimeric membrane glycoproteins consisting of non-covalently associated ? and ? subunits. More than 18 ? and 8 ? subunits with numerous splice variant isoforms have been identified in mammals. In general, integrins function as receptors for extracellular matrix proteins. Certain integrins can also bind to soluble ligands or to counter-receptors on adjacent cells, such as the intracellular adhesion molecules (ICAMs), resulting in aggregation of cells. Signals transduced by integrins play a role in many biological processes, including cell growth, differentiation, migRation and apoptosis. For integrin subunits ?3 and ?6, two cytoplasmic variants, A and B, have been identified.
Caution:
This product is intended FOR RESEARCH USE ONLY, and FOR TESTS IN VITRO, not for use in diagnostic or therapeutic procedures involving humans or animals.
This product contains sodium azide. To prevent formation of toxic vapors, do not mix with strong acidic solutions. To prevent formation of potentially explosive metallic azides in metal plumbing, always wash into drain with copious quantities of water.
This datasheet is as accurate as reasonably achievable, but Nordic-MUbio accepts no liability for any inaccuracies or omissions in this information.
Field of Interest:
Cancer|Cell adhesion
Formulation:
Each vial contains 100 ul 1 mg/ml purified monoclonal antibody in PBS containing 0.09% sodium azide.
Product:
Each vial contains 100 ul 1 mg/ml purified monoclonal antibody in PBS containing 0.09% sodium azide.
Source:
29A3 is a Mouse monoclonal IgG1, ? antibody derived by fusion of SP2/0 Mouse myeloma cells with spleen cells from a BALB/c Mouse immunized with a synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit ?3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin.
Species Reactivity:
A broad species reactivity is expected because of the conserved nature of the epitope.
Specificity:
29A3 recognizes specifically the cytoplasmic domain of integrin subunit ?3A which is present in the basal cell layer in skin, glomeruli, Bowman?s capsules and distal tubuli in kidney, all vascular and capillary endothelia in brain, heart and skin, and vascular smooth muscle cells in heart.
UniProt:
P26006

References

1. Delwel, G. O., de Melker, A. A., Hogervorst, F., Jaspars, L. H., Fles, D. L., Kuikman, I., Lindblom, A., Paulsson, M., Timpl, R., and Sonnenberg, A. (1994). Distinct and overlapping ligand specificities of the alpha 3A beta 1 and alpha 6A beta 1 integrins: recognition of laminin isoforms, Mol Biol Cell 5, 203-15.
2. de Melker, A. A., Sterk, L. M., Delwel, G. O., Fles, D. L., Daams, H., Weening, J. J., and Sonnenberg, A. (1997). The A and B variants of the alpha 3 integrin subunit: tissue distribution and functional characterization, Lab Invest 76, 547-63.