NSJ Bioreagents

ACCN1 Antibody / ASIC2

Product Code:
 
NSJ-R32514
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Rat
Application:
 
Western Blot (WB)
Storage:
 
After reconstitution, the ACCN1 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 1
Western blot testing of 1) rat testis and 2) human MCF7 lysate with ACCN1 antibody at 0.5ug/ml. Predicted molecular weight ~58 kDa.
❮❯

Western blot testing of 1) rat testis and 2) human MCF7 lysate with ACCN1 antibody at 0.5ug/ml. Predicted molecular weight ~58 kDa.

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-R32514-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
How to order with us   Contact us
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Western blot: 0.5-1ug/ml
Buffer:
Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
Description:
Amiloride-sensitive cation channel 1, neuronal, also known as ASIC2, is a protein that in humans is encoded by the ACCN1 gene. This gene encodes a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. The members of this family are amiloride-sensitive sodium channels that contain intracellular N and C termini, 2 hydrophobic transmembrane regions, and a large extracellular loop, which has many cysteine residues with conserved spacing. The member encoded by this gene may play a role in neurotransmission. In addition, a heteromeric association between this member and acid-sensing (proton-gated) ion channel 3 has been observed to co-assemble into proton-gated channels sensitive to gadolinium. Alternative splicing has been observed at this locus and two variants, encoding distinct isoforms, have been identified.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids 112-147 (ELLALLDVNLQIPDPHLADPSVLEALRQKANFKHYK from the human protein were used as the immunogen for the ACCN1 antibody.
Limitation:
This ACCN1 antibody is available for research use only.
Localization:
Cytoplasmic
Purity:
Antigen affinity
Species Reactivity :
Human, Rat
Uniprot #:
Q16515