NSJ Bioreagents

ACTH Antibody

Product Code:
 
NSJ-R31470
Product Group:
 
Primary Antibodies
Supplier:
 
NSJ Bioreagents
Host Type:
 
Rabbit
Antibody Isotype:
 
Rabbit IgG
Antibody Clonality:
 
Polyclonal
Regulatory Status:
 
RUO
Target Species:
  • Human
  • Mouse
  • Rat
Application:
 
Immunohistochemistry- Paraffin Embedded (IHC-P)
Storage:
 
After reconstitution, the ACTH antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
1 / 3
IHC-P: ACTH antibody testing of rat kidney tissue
2 / 3
IHC-P: ACTH antibody testing of rat brain tissue
3 / 3
IHC-P: ACTH antibody testing of mouse kidney tissue
❮❯

IHC-P: ACTH antibody testing of rat kidney tissue
IHC-P: ACTH antibody testing of rat brain tissue
IHC-P: ACTH antibody testing of mouse kidney tissue

No additional charges, what you see is what you pay! *

CodeSizePrice
NSJ-R31470-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT
How to order with us   Contact us
Stay in control of your spending. These prices have no additional charges, not even shipping!
* Rare exceptions are clearly labelled (only 0.14% of items!).
Multibuy discounts available! Contact us to find what you can save.
This product comes from: United States.
Typical lead time: 10-14 working days.
Contact us for more accurate information.
  • Further Information
  • Documents
  • Show All

Further Information

Application Details :
Immunohistochemistry (FFPE): 0.5-1ug/ml
Application Note:
The stated application concentrations are suggested starting amounts. Titration of the ACTH antibody may be required due to differences in protocols and secondary/substrate sensitivity.
Description:
Adrenocorticotropic hormone (ACTH), also known as Corticotropin, is a polypeptide tropic hormone produced and secreted by the anterior pituitary gland. It is an important component of the hypothalamic-pituitary-adrenal axis and is often produced in response to biological stress (along with its precursor corticotropin-releasing hormone from the hypothalamus). Its principal effects are increased production and release of corticosteroids. ACTH stimulates secretion of glucocorticoid steroid hormones from adrenal cortex cells, especially in the zona fasciculata of the adrenal glands. This gene can influence steroid hormone secretion by both rapid short-term mechanisms that take place within minutes and slower long-term actions. Besides, ACTH also enhances transcription of mitochondrial genes that encode for subunits of mitochondrial oxidative phosphorylation systems.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Gene ID #:
5443
Immunogen:
An amino acid sequence from the middle region of human Adrenocorticotropic hormone (SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF) was used as the immunogen for this ACTH antibody.
Limitation:
This ACTH antibody is available for research use only.
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat