ADRA1A Antibody

Contact us
NSJ Bioreagents
Product Code: NSJ-R32076
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-R32076-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Application: Western Blot (WB)
Storage:
After reconstitution, the ADRA1A antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 5
Western blot testing of 1) rat heart, 2) rat brain, 3) rat liver, 4) mouse liver, 5) mouse lung, 6) human 22RV1, and 7) human SMMC lysate with ADRA1A antibody. Expected/observed molecular weight ~52 kDa.
2 / 5
IHC staining of FFPE human liver cancer with ADRA1A antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
3 / 5
IHC staining of FFPE rat brain with ADRA1A antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
4 / 5
IHC staining of FFPE rat brain with ADRA1A antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
5 / 5
Flow cytometry testing of human A431 cells with ADRA1A antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= ADRA1A antibody.
❮❯

Western blot testing of 1) rat heart, 2) rat brain, 3) rat liver, 4) mouse liver, 5) mouse lung, 6) human 22RV1, and 7) human SMMC lysate with ADRA1A antibody. Expected/observed molecular weight ~52 kDa.
IHC staining of FFPE human liver cancer with ADRA1A antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
IHC staining of FFPE rat brain with ADRA1A antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
IHC staining of FFPE rat brain with ADRA1A antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
Flow cytometry testing of human A431 cells with ADRA1A antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= ADRA1A antibody.

Documents

Further Information

Application Details :
Western blot: 0.1-0.5ug/ml,Flow cytometry: 1-3ug/10^6 cells,Immunohistochemistry (FFPE): 1-2ug/ml
Application Note:
Optimal dilution of the ADRA1A antibody should be determined by the researcher.
Description:
ADRA1A, also known as alpha-1A adrenergic receptor, is an alpha-1 adrenergic receptor, and also denotes the human gene encoding it. This gene is mapped to 8p21.2. Alpha-1-adrenergic receptors are G protein-coupled transmembrane receptors that mediate actions in the sympathetic nervous system through the binding of the catecholamines, epinephrine and norepinephrine. It has been found that ADRA1A transcripts in heart, brain, liver, and prostate. ADRA1A is the predominant ADRA1 subtype in liver and heart, and it can mediate the contraction of prostate smooth muscle.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids KAFQNVLRIQCLCRKQSSKHALGYTLHPPSQAVEGQHKD of human ADRA1A were used as the immunogen for the ADRA1A antibody.
Limitation:
This ADRA1A antibody is available for research use only.
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
P35348