AGO1 Antibody / Argonaute 1

Contact us
NSJ Bioreagents
Product Code: NSJ-R32801
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-R32801-100ug100ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Fluorescence-activated cell sorting (FACS)
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
After reconstitution, the AGO1 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 6
IHC testing of FFPE human breast cancer tissue with AGO1 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
2 / 6
IHC testing of FFPE rat spleen tissue with AGO1 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
3 / 6
IHC testing of FFPE rat lung tissue with AGO1 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
4 / 6
Western blot testing of 1) rat brain, 2) rat kidney, 3) rat NRK, 4) mouse brain, 5) mouse kidney, 6) human HeLa, 7) human Jurkat and 8) human K562 lysate with AGO1 antibody at 0.5ug/ml. Predicted molecular weight ~97 kDa.
5 / 6
Flow cytometry testing of human HL60 cells with AGO1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=AGO1 antibody.
6 / 6
Immunofluorescent staining of FFPE human U-2 OS cells with AGO1 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
❮❯

IHC testing of FFPE human breast cancer tissue with AGO1 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
IHC testing of FFPE rat spleen tissue with AGO1 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
IHC testing of FFPE rat lung tissue with AGO1 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
Western blot testing of 1) rat brain, 2) rat kidney, 3) rat NRK, 4) mouse brain, 5) mouse kidney, 6) human HeLa, 7) human Jurkat and 8) human K562 lysate with AGO1 antibody at 0.5ug/ml. Predicted molecular weight ~97 kDa.
Flow cytometry testing of human HL60 cells with AGO1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=AGO1 antibody.
Immunofluorescent staining of FFPE human U-2 OS cells with AGO1 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.

Documents

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Flow cytometry: 1-3ug/10^6 cells,Immunohistochemistry (FFPE): 1-2ug/ml,Immunofluorescence (FFPE): 2-4ug/ml
Application Note:
Optimal dilution of the AGO1 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
Description:
This gene encodes a member of the argonaute family of proteins, which associate with small RNAs and have important roles in RNA interference (RNAi) and RNA silencing. This protein binds to microRNAs (miRNAs) or small interfering RNAs (siRNAs) and represses translation of mRNAs that are complementary to them. It is also involved in transcriptional gene silencing (TGS) of promoter regions that are complementary to bound short antigene RNAs (agRNAs), as well as in the degradation of miRNA-bound mRNA targets. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. A recent study showed this gene to be an authentic stop codon readthrough target, and that its mRNA could give rise to an additional C-terminally extended isoform by use of an alternative in-frame translation termination codon.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids 376-409 (EISRLMKNASYNLDPYIQEFGIKVKDDMTEVTGR) from the human protein were used as the immunogen for the AGO1 antibody.
Limitation:
This AGO1 antibody is available for research use only.
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
Q9UL18