AK1 Antibody / Adenylate Kinase 1

Contact us
NSJ Bioreagents
Product Code: NSJ-R32501
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-R32501-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Application: Western Blot (WB)
Storage:
After reconstitution, the AK1 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 3
Immunofluorescent staining of FFPE human U-2 OS cells with AK1 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
2 / 3
Flow cytometry testing of human A431 cells with AK1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= AK1 antibody.
3 / 3
Western blot testing of 1) rat skeletal muscle, 2) mouse heart and 3) human COLO320 lysate with ADO antibody at 0.5ug/ml. Predicted molecular weight ~22 kDa.
❮❯

Immunofluorescent staining of FFPE human U-2 OS cells with AK1 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
Flow cytometry testing of human A431 cells with AK1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= AK1 antibody.
Western blot testing of 1) rat skeletal muscle, 2) mouse heart and 3) human COLO320 lysate with ADO antibody at 0.5ug/ml. Predicted molecular weight ~22 kDa.

Documents

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunofluorescence (FFFPE): 2-4ug/ml,Flow cytometry: 1-3ug/million cells
Buffer:
Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
Description:
This gene encodes an adenylate kinase enzyme involved in energy metabolism and homeostasis of cellular adenine nucleotide ratios in different intracellular compartments. This gene is highly expressed in skeletal muscle, brain and erythrocytes. Certain mutations in this gene resulting in a functionally inadequate enzyme are associated with a rare genetic disorder causing nonspherocytic hemolytic anemia. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids 149-189 (RLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTH) from the human protein were used as the immunogen for the AK1 antibody.
Limitation:
This AK1 antibody is available for research use only.
Localization:
Cytoplasmic
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
P00568