ALDH1B1 Antibody

Contact us
NSJ Bioreagents
Product Code: NSJ-R32505
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-R32505-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Application: Western Blot (WB)
Storage:
After reconstitution, the ALDH1B1 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 11
Western blot testing of 1) rat liver, 2) rat testis, 3) rat RH35, 4) mouse brain and 5) mouse liver tissue lysate with ALDH1B1 antibody. Predicted molecular weight ~57 kDa.
2 / 11
Western blot testing of human 1) HepG2, 2) K562, 3) A431, 4) A549, 5) U-2 OS, 6) HeLa and 7) monkey COS-7 cell lysate with ALDH1B1 antibody. Predicted molecular weight ~57 kDa.
3 / 11
Immunofluorescent staining of FFPE human A431 cells with ALDH1B1 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
4 / 11
IHC staining of FFPE human colonic adenocarcinoma with ALDH1B1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
5 / 11
IHC staining of FFPE human colon cancer with ALDH1B1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
6 / 11
IHC staining of FFPE human endometrial adenocarcinoma with ALDH1B1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
7 / 11
IHC staining of FFPE human hepatocellular carcinoma with ALDH1B1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
8 / 11
IHC staining of FFPE human laryngeal squamous cell carcinoma with ALDH1B1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
9 / 11
IHC staining of FFPE mouse colon with ALDH1B1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
10 / 11
IHC staining of FFPE rat colon with ALDH1B1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
11 / 11
Flow cytometry testing of human HEL cells with ALDH1B1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= ALDH1B1 antibody.
❮❯

Western blot testing of 1) rat liver, 2) rat testis, 3) rat RH35, 4) mouse brain and 5) mouse liver tissue lysate with ALDH1B1 antibody. Predicted molecular weight ~57 kDa.
Western blot testing of human 1) HepG2, 2) K562, 3) A431, 4) A549, 5) U-2 OS, 6) HeLa and 7) monkey COS-7 cell lysate with ALDH1B1 antibody. Predicted molecular weight ~57 kDa.
Immunofluorescent staining of FFPE human A431 cells with ALDH1B1 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
IHC staining of FFPE human colonic adenocarcinoma with ALDH1B1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human colon cancer with ALDH1B1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human endometrial adenocarcinoma with ALDH1B1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human hepatocellular carcinoma with ALDH1B1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human laryngeal squamous cell carcinoma with ALDH1B1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE mouse colon with ALDH1B1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE rat colon with ALDH1B1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
Flow cytometry testing of human HEL cells with ALDH1B1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= ALDH1B1 antibody.

Documents

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml,Immunofluorescence (FFPE): 2-4ug/ml,Flow cytometry: 1-3ug/million cells
Buffer:
Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
Description:
Aldehyde dehydrogenase X, mitochondrial is an enzyme that in humans is encoded by the ALDH1B1 gene. This protein belongs to the aldehyde dehydrogenases family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. This gene does not contain introns in the coding sequence. The variation of this locus may affect the development of alcohol-related problems.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids 116-156 (RVYLASLETLDNGKPFQESYALDLDEVIKVYRYFAGWADKW from the human protein were used as the immunogen for the ALDH1B1 antibody.
Limitation:
This ALDH1B1 antibody is available for research use only.
Localization:
Cytoplasmic, granular
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
P30837