ALDH2 Antibody
Code | Size | Price |
---|
NSJ-R31890-100ug | 100 ug | £535.00 |
Quantity:
Prices exclude any Taxes / VAT
Overview
Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
- Human
- Mouse
- Rat
Applications:
- Immunohistochemistry- Paraffin Embedded (IHC-P)
- Western Blot (WB)
Storage:
After reconstitution, the ALDH2 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
Images
Documents
Further Information
Application Details :
Western blot: 0.1-0.5ug/ml,Immunohistochemistry (FFPE): 0.5-1ug/ml,Immunofluorescence: 2-4ug/ml
Application Note:
Optimal dilution of the ALDH2 antibody should be determined by the researcher.
Description:
ALDH2 (Aldehyde Dehydrogenase 2 Family) is a human gene. The enzyme encoded by this gene belongs to the aldehyde dehydrogenase family of enzymes that catalyze the chemical transformation from acetaldehyde to acetic acid. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. Hsu et al. (1985) assigned the ALDH2 locus to chromosome 12 by means of a cDNA probe and Southern blot analysis of somatic cell hybrids. Using an unbiased proteomic search, Chen et al. (2008) identified mitochondrial ALDH2 as an enzyme whose activation correlated with reduced ischemic heart damage in rodent models. A high-throughput screen identified a small molecule activator of ALDH2, which they called Alda-1, that, when administered to rats before an ischemic event, reduced infarct size by 60%, most likely through its inhibitory effect on the formation of cytotoxic aldehydes.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids SAAATQAVPAPNQQPEVFCNQIFINNEWHDA of human ALDH2 were used as the immunogen for the ALDH2 antibody.
Limitation:
This ALDH2 antibody is available for research use only.
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
P05091