AMHR2 Antibody

Contact us
NSJ Bioreagents
Product Code: NSJ-R32469
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-R32469-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Human
  • Rat
Application: Western Blot (WB)
Storage:
Prior to reconstitution, store at 40. After reconstitution, the AMHR2 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 7
IHC staining of FFPE human ovarian cancer tissue with AMHR2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
2 / 7
IHC staining of FFPE human testis cancer tissue with AMHR2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
3 / 7
IHC staining of FFPE mouse testis tissue with AMHR2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
4 / 7
IHC staining of FFPE rat testis tissue with AMHR2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
5 / 7
Immunofluorescent staining of FFPE human Caco-2 cells with AMHR2 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
6 / 7
Western blot testing of human 1) 293T, 2) MCF7, 3) HL60, 4) Caco-2, 5) K562, 6) HepG2, 7) PC-3 and 8) A549 cell lysate with AMHR2 antibody at 0.5ug/ml. Predicted molecular weight: ~63 kDa.
7 / 7
Flow cytometry testing of human K562 cells with AMHR2 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= AMHR2 antibody.
❮❯

IHC staining of FFPE human ovarian cancer tissue with AMHR2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human testis cancer tissue with AMHR2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE mouse testis tissue with AMHR2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE rat testis tissue with AMHR2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
Immunofluorescent staining of FFPE human Caco-2 cells with AMHR2 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
Western blot testing of human 1) 293T, 2) MCF7, 3) HL60, 4) Caco-2, 5) K562, 6) HepG2, 7) PC-3 and 8) A549 cell lysate with AMHR2 antibody at 0.5ug/ml. Predicted molecular weight: ~63 kDa.
Flow cytometry testing of human K562 cells with AMHR2 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= AMHR2 antibody.

Documents

Further Information

Application Details :
Western blot: 0.5-1ug/ml
Buffer:
Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
Description:
AMHR2 is the receptor for the anti-Mullerian hormone (AMH) which, in addition to testosterone, results in male sex differentiation. AMH and testosterone are produced in the testes by different cells and have different effects. Testosterone promotes the development of male genitalia while the binding of AMH to the encoded receptor prevents the development of the mullerian ducts into uterus and Fallopian tubes. Mutations in this gene are associated with persistent Mullerian duct syndrome type II. Alternatively spliced transcript variants encoding different isoforms have been identified.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids QRYMAPELLDKTLDLQDWGMALRRADIYSLALLLWE were used as the immunogen for the AMHR2 antibody.
Limitation:
This AMHR2 antibody is available for research use only.
Purity:
Antigen affinity
Species Reactivity :
Human, Rat
Uniprot #:
Q16671