AMPK beta 2 Antibody / PRKAB2

Contact us
NSJ Bioreagents
Product Code: NSJ-R31820
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-R31820-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
After reconstitution, the PRKAB2 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 6
Immunofluorescent staining of FFPE human A431 cells with AMPK beta 2 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
2 / 6
IHC testing of FFPE human lung cancer tissue with PRKAB2 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
3 / 6
IHC testing of FFPE mouse intestine with PRKAB2 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
4 / 6
IHC testing of FFPE rat intestine with PRKAB2 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
5 / 6
Flow cytometry testing of human A431 cells with AMPK beta 2 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= AMPK beta 2 antibody.
6 / 6
Western blot testing of 1) rat brain, 2) rat skeletal muscle and 3) human PANC lysate with PRKAB2 antibody. Expected molecular weight ~30 kDa.
❮❯

Immunofluorescent staining of FFPE human A431 cells with AMPK beta 2 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
IHC testing of FFPE human lung cancer tissue with PRKAB2 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE mouse intestine with PRKAB2 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE rat intestine with PRKAB2 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
Flow cytometry testing of human A431 cells with AMPK beta 2 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= AMPK beta 2 antibody.
Western blot testing of 1) rat brain, 2) rat skeletal muscle and 3) human PANC lysate with PRKAB2 antibody. Expected molecular weight ~30 kDa.

Documents

Further Information

Application Details :
Western blot: 0.1-0.5ug/ml,Immunohistochemistry (FFPE): 0.5-1ug/ml,Flow cytometry: 1-3ug/10^6 cells,Immunofluorescence (FFPE): 2-4ug/ml
Application Note:
Optimal dilution of the PRKAB2 antibody should be determined by the researcher.
Description:
5'-AMP-activated protein kinase subunit beta-2 is an enzyme that in humans is encoded by the PRKAB2 gene. The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. It is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This subunit may be a positive regulator of AMPK activity. It is highly expressed in skeletal muscle and thus may have tissue-specific roles. Multiple alternatively spliced transcript variants have been found for this gene.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids DKEFVSWQQDLEDSVKPTQQARPTVIRWSEGGKE of human AMPK beta 2 were used as the immunogen for the PRKAB2 antibody.
Limitation:
This PRKAB2 antibody is available for research use only.
Localization:
Cytoplasmic
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
O43741