AQP1 Antibody / Aquaporin 1

Contact us
NSJ Bioreagents
Product Code: NSJ-R32050
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-R32050-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
After reconstitution, the Aquaporin 1 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 14
IHC staining of FFPE human bladder urothelial carcinoma tissue with Aquaporin 1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
2 / 14
IHC testing of FFPE human intestinal cancer with Aquaporin 1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
3 / 14
IHC staining of FFPE human rectal cancer tissue with Aquaporin 1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
4 / 14
IHC staining of FFPE human liver cancer tissue with Aquaporin 1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
5 / 14
IHC staining of FFPE human lung cancer tissue with Aquaporin 1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
6 / 14
IHC staining of FFPE human tonsil tissue with Aquaporin 1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
7 / 14
IHC staining of FFPE mouse kidney tissue with Aquaporin 1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
8 / 14
IHC testing of FFPE mouse kidney with Aquaporin 1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
9 / 14
IHC staining of FFPE rat kidney tissue with Aquaporin 1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
10 / 14
IHC testing of FFPE rat kidney with Aquaporin 1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
11 / 14
Immunofluorescent staining of FFPE human lung cancer tissue with Aquaporin 1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
12 / 14
Immunofluorescent staining of FFPE rat kidney tissue with Aquaporin 1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
13 / 14
Western blot testing of 1) rat kidney, 2) mouse kidney and 3) mouse lung tissue lysate with Aquaporin 1 antibody. Expected molecular weight ~28 kDa.
14 / 14
Flow cytometry testing of human SH-SY5Y cells with Aquaporin 1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= Aquaporin 1 antibody.
❮❯

IHC staining of FFPE human bladder urothelial carcinoma tissue with Aquaporin 1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC testing of FFPE human intestinal cancer with Aquaporin 1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC staining of FFPE human rectal cancer tissue with Aquaporin 1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human liver cancer tissue with Aquaporin 1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human lung cancer tissue with Aquaporin 1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human tonsil tissue with Aquaporin 1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE mouse kidney tissue with Aquaporin 1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC testing of FFPE mouse kidney with Aquaporin 1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC staining of FFPE rat kidney tissue with Aquaporin 1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC testing of FFPE rat kidney with Aquaporin 1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
Immunofluorescent staining of FFPE human lung cancer tissue with Aquaporin 1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
Immunofluorescent staining of FFPE rat kidney tissue with Aquaporin 1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
Western blot testing of 1) rat kidney, 2) mouse kidney and 3) mouse lung tissue lysate with Aquaporin 1 antibody. Expected molecular weight ~28 kDa.
Flow cytometry testing of human SH-SY5Y cells with Aquaporin 1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= Aquaporin 1 antibody.

Documents

Further Information

Application Details :
Western blot: 0.1-0.5ug/ml,Immunohistochemistry (FFPE): 0.5-1ug/ml,Immunofluorescence (FFPE): 2-4ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the Aquaporin 1 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
Aquaporin 1 is a 28-kD integral protein thought at first to be a breakdown product of the Rh polypeptide but was later shown to be a unique molecule that is abundant in erythrocytes and renal tubules. AQP1 is also expressed by the choroid plexus and various other tissues. It forms a water-specific channel that provides the plasma membranes of red cells and kidney proximal tubules with high permeability to water, thereby permitting water to move in the direction of an osmotic gradient.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids DRVKVWTSGQVEEYDLDADDINSRVEMKPK of human Aquaporin 1 were used as the immunogen for the Aquaporin 1 antibody.
Limitation:
This Aquaporin 1 antibody is available for research use only.
Localization:
Membrane
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
P29972