ARC Antibody / Activity-regulated cytoskeleton-associated protein

Contact us
NSJ Bioreagents
Product Code: NSJ-R32271
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-R32271-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Application: Western Blot (WB)
Storage:
After reconstitution, the ARC antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 1
Western blot testing of 1) rat brain, 2) rat testis, 3) mouse brain, 4) human PANC, 5) human HeLa and 6) human MCF7 lysate with ARC antibody. Expected/observed molecular weight ~45 kDa.
❮❯

Western blot testing of 1) rat brain, 2) rat testis, 3) mouse brain, 4) human PANC, 5) human HeLa and 6) human MCF7 lysate with ARC antibody. Expected/observed molecular weight ~45 kDa.

Documents

Further Information

Application Details :
Western blot: 0.1-0.5ug/ml
Application Note:
Optimal dilution of the ARC antibody should be determined by the researcher.
Description:
Arc is widely considered to be an important protein in neurobiology and also a significant tool for systems neuroscience.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids KLKRFLRHPLPKTLEQLIQRGMEVQDDLEQAAEPA of human ARC were used as the immunogen for the ARC antibody.
Limitation:
This ARC antibody is available for research use only.
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
Q7LC44