ASPH Antibody

Contact us
NSJ Bioreagents
Product Code: NSJ-R32203
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-R32203-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
After reconstitution, the ASPH antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 5
Western blot testing of 1) rat brain, 2) rat liver, 3) human HeLa, 4) HepG2 and 5) mouse HEPA lysate with ASPH antibody. Predicted molecular weight ~86 kDa, observed here at ~100 kDa.
2 / 5
IHC testing of FFPE human breast cancer tissue with ASPH antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
3 / 5
ICC staining of FFPE human A549 cells with ASPH antibody at 1ug/ml. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
4 / 5
Flow cytometry testing of human U-87 MG cells with ASPH antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= ASPH antibody.
5 / 5
Flow cytometry testing of human HeLa cells with ASPH antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= ASPH antibody.
❮❯

Western blot testing of 1) rat brain, 2) rat liver, 3) human HeLa, 4) HepG2 and 5) mouse HEPA lysate with ASPH antibody. Predicted molecular weight ~86 kDa, observed here at ~100 kDa.
IHC testing of FFPE human breast cancer tissue with ASPH antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
ICC staining of FFPE human A549 cells with ASPH antibody at 1ug/ml. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
Flow cytometry testing of human U-87 MG cells with ASPH antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= ASPH antibody.
Flow cytometry testing of human HeLa cells with ASPH antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= ASPH antibody.

Documents

Further Information

Application Details :
Western blot: 0.1-0.5ug/ml,Immunohistochemistry (FFPE): 0.5-1ug/ml,Immunocytochemistry : 1-2ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the ASPH antibody should be determined by the researcher.
Description:
ASPH is also known as Aspartyl/asparaginyl beta-hydroxylase or aspartate beta-hydroxylase. This gene is thought to play an important role in calcium homeostasis. And the gene is expressed from two promoters and undergoes extensive alternative splicing. The encoded set of proteins share varying amounts of overlap near their N-termini but have substantial variations in their C-terminal domains resulting in distinct functional properties. The longest isoforms (a and f) include a C-terminal Aspartyl/Asparaginyl beta-hydroxylase domain that hydroxylates aspartic acid or asparagine residues in the epidermal growth factor (EGF)-like domains of some proteins, including protein C, coagulation factors VII, IX, and X, and the complement factors C1R and C1S. Other isoforms differ primarily in the C-terminal sequence and lack the hydroxylase domain, and some have been localized to the endoplasmic and sarcoplasmic reticulum. Some of these isoforms are found in complexes with calsequestrin, triadin, and the ryanodine receptor, and have been shown to regulate calcium release from the sarcoplasmic reticulum. Some isoforms have been implicated in metastasis.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids EVWQDASSFRLIFIVDVWHPELTPQQRRSLPAI of human ASPH were used as the immunogen for the ASPH antibody.
Limitation:
This ASPH antibody is available for research use only.
Localization:
Cytoplasmic
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
Q12797