ASXL1 Antibody

Contact us
NSJ Bioreagents
Product Code: NSJ-RQ4183
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-RQ4183-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
Application: Western Blot (WB)
Storage:
After reconstitution, the ASXL1 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 3
Western blot testing of human 1) HeLa, 2) COLO320, 3) 293T, 4) Jurkat and 5) mouse testis lysate with ASXL1 antibody at 0.5ug/ml. Predicted molecular weight ~165 kDa, observed here at ~220 kDa.
2 / 3
Flow cytometry testing of human U-2 OS cells with ASXL1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= ASXL1 antibody.
3 / 3
Flow cytometry testing of human HepG2 cells with ASXL1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= ASXL1 antibody.
❮❯

Western blot testing of human 1) HeLa, 2) COLO320, 3) 293T, 4) Jurkat and 5) mouse testis lysate with ASXL1 antibody at 0.5ug/ml. Predicted molecular weight ~165 kDa, observed here at ~220 kDa.
Flow cytometry testing of human U-2 OS cells with ASXL1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= ASXL1 antibody.
Flow cytometry testing of human HepG2 cells with ASXL1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= ASXL1 antibody.

Documents

Further Information

Application Details :
Western Blot: 0.5-1ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the ASXL1 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
Putative Polycomb group protein ASXL1 is a protein that in humans is encoded by the ASXL1 gene. This gene is similar to the Drosophila additional sex combs gene, which encodes a chromatin-binding protein required for normal determination of segment identity in the developing embryo. The protein is a member of the Polycomb group of proteins, which are necessary for the maintenance of stable repression of homeotic and other loci. The protein is thought to disrupt chromatin in localized areas, enhancing transcription of certain genes while repressing the transcription of other genes. The protein encoded by this gene functions as a ligand-dependent co-activator for retinoic acid receptor in cooperation with nuclear receptor coactivator 1. Mutations in this gene are associated with myelodysplastic syndromes and chronic myelomonocytic leukemia. Alternative splicing results in multiple transcript variants.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids KKERTWAEAARLVLENYSDAPMTPKQILQVIEAE were used as the immunogen for the ASXL1 antibody.
Limitation:
This ASXL1 antibody is available for research use only.
Purity:
Antigen affinity purified
Species Reactivity :
Human, Mouse
Uniprot #:
Q8IXJ9