ATG13 Antibody
| Code | Size | Price |
|---|
| NSJ-R31833-100ug | 100 ug | £535.00 |
Quantity:
Prices exclude any Taxes / VAT
Overview
Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
- Human
- Mouse
Application: Western Blot (WB)
Storage:
After reconstitution, the ATG13 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
Documents
Further Information
Application Details :
Western blot: 0.1-0.5ug/ml
Application Note:
Optimal dilution of the ATG13 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose
Description:
Autophagy-related protein 13, also known as ATG13, is a protein that in humans is encoded by the KIAA0652 gene. ATG13 is an autophagy factor required for phagosome formation. It is located on 11p11.2. And ATG13 is a target of the TOR kinase signaling pathway that regulates autophagy through phosphorylation of ATG13 and ULK1, and the regulation of the ATG13-ULK1-RB1CC1 complex.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids MAEDLDSLPEKLAVHEKNVREFDAFVETLQ of human ATG13 were used as the immunogen for the ATG13 antibody.
Limitation:
This ATG13 antibody is available for research use only.
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse
Uniprot #:
O75143