CCDC6 Antibody

NSJ Bioreagents
Product Code: NSJ-R32518
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-R32518-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Human
  • Rat
Application: Western Blot (WB)
Storage:
After reconstitution, the CCDC6 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 1
Western blot testing of 1) rat testis and 2) human MCF7 lysate with CCDC6 antibody at 0.5ug/ml. Predicted molecular weight ~53 kDa, routinely observed at ~65 kDa.

Western blot testing of 1) rat testis and 2) human MCF7 lysate with CCDC6 antibody at 0.5ug/ml. Predicted molecular weight ~53 kDa, routinely observed at ~65 kDa.

Further Information

Application Details :
Western blot: 0.5-1ug/ml
Buffer:
Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
Description:
Coiled-coil domain-containing protein 6 is a protein that in humans is encoded by the CCDC6 gene. This gene encodes a coiled-coil domain-containing protein. The encoded protein is ubiquitously expressed and may function as a tumor suppressor. A chromosomal rearrangement resulting in the expression of a fusion gene containing a portion of this gene and the intracellular kinase-encoding domain of the ret proto-oncogene is the cause of thyroid papillary carcinoma.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids 156-198 (KAELEQHLEQEQEFQVNKLMKKIKKLENDTISKQLTLEQLRRE) from the human protein were used as the immunogen for the CCDC6 antibody.
Limitation:
This CCDC6 antibody is available for research use only.
Localization:
Cytoplasmic
Purity:
Antigen affinity
Species Reactivity :
Human, Rat
Uniprot #:
Q16204