CCKBR Antibody

Contact us
NSJ Bioreagents
Product Code: NSJ-RQ4324
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-RQ4324-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Fluorescence-activated cell sorting (FACS)
  • Western Blot (WB)
Storage:
After reconstitution, the CCKBR antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 3
Western blot testing of human 1) PANC-1, 2) U-87 MG, 3) COLO-320 and 4) SGC-7901 cell lysate with CCKBR antibody at 0.5ug/ml. Predicted molecular weight ~48 kDa, but can be observed at 68-97 kDa.
2 / 3
Western blot testing of 1) rat brain, 2) rat stomach and 3) mouse brain lysate with CCKBR antibody at 0.5ug/ml. Predicted molecular weight ~48 kDa, but can be observed at 68-97 kDa.
3 / 3
Flow cytometry testing of human LoVo cells with CCKBR antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=CCKBR antibody.
❮❯

Western blot testing of human 1) PANC-1, 2) U-87 MG, 3) COLO-320 and 4) SGC-7901 cell lysate with CCKBR antibody at 0.5ug/ml. Predicted molecular weight ~48 kDa, but can be observed at 68-97 kDa.
Western blot testing of 1) rat brain, 2) rat stomach and 3) mouse brain lysate with CCKBR antibody at 0.5ug/ml. Predicted molecular weight ~48 kDa, but can be observed at 68-97 kDa.
Flow cytometry testing of human LoVo cells with CCKBR antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=CCKBR antibody.

Documents

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the CCKBR antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
The cholecystokinin B receptor, also known as CCKBR or CCK2, is a protein that in humans is encoded by the CCKBR gene. This gene encodes a G-protein coupled receptor for gastrin and cholecystokinin (CCK), regulatory peptides of the brain and gastrointestinal tract. This protein is a type B gastrin receptor, which has a high affinity for both sulfated and nonsulfated CCK analogs and is found principally in the central nervous system and the gastrointestinal tract. Alternative splicing results in multiple transcript variants. A misspliced transcript variant including an intron has been observed in cells from colorectal and pancreatic tumors.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids PVYTVVQPVGPRVLQCVHRWPSARVRQTWS were used as the immunogen for the CCKBR antibody.
Limitation:
This CCKBR antibody is available for research use only.
Localization:
Cell membrane
Purity:
Antigen affinity purified
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
P32239