CD41 Antibody / ITGA2B

Contact us
NSJ Bioreagents
Product Code: NSJ-R31916
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-R31916-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
After reconstitution, the CD41 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 5
Western blot testing of human 1) HEK293 and 2) HepG2 cell lysate with CD41 antibody. Expected molecular weight ~120 kDa.
2 / 5
Western blot testing of 1) rat spleen and 2) mouse spleen lysate with CD41 antibody. Expected molecular weight ~120 kDa.
3 / 5
IHC testing of FFPE human breast cancer with CD41 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
4 / 5
IHC testing of FFPE mouse lung with CD41 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
5 / 5
IHC testing of FFPE rat lung with CD41 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
❮❯

Western blot testing of human 1) HEK293 and 2) HepG2 cell lysate with CD41 antibody. Expected molecular weight ~120 kDa.
Western blot testing of 1) rat spleen and 2) mouse spleen lysate with CD41 antibody. Expected molecular weight ~120 kDa.
IHC testing of FFPE human breast cancer with CD41 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE mouse lung with CD41 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE rat lung with CD41 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.

Documents

Further Information

Application Details :
Western blot: 0.1-0.5ug/ml,Immunohistochemistry (FFPE): 0.5-1ug/ml
Application Note:
Optimal dilution of the CD41 antibody should be determined by the researcher.
Description:
Integrin alpha-IIb is a protein that in humans is encoded by the ITGA2B gene. It is mapped to 17q21.32. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. Alpha chain 2b undergoes post-translational cleavage to yield disulfide-linked light and heavy chains that join with beta 3 to form a fibrinogen receptor expressed in platelets that plays a crucial role in coagulation. Mutations that interfere with this role result in thrombasthenia. In addition to adhesion, integrins are known to participate in cell-surface mediated signalling.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids EAELAVHLPQGAHYMRALSNVEGFERLICNQKKEN of human ITGA2B/CD41 were used as the immunogen for the CD41 antibody.
Limitation:
This CD41 antibody is available for research use only.
Localization:
Cytoplasmic, membrane
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
P08514