CD5 Antibody

Contact us
NSJ Bioreagents
Product Code: NSJ-RQ4028
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-RQ4028-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Fluorescence-activated cell sorting (FACS)
  • Western Blot (WB)
Storage:
After reconstitution, the CD5 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 2
Western blot testing of 1) rat liver, 2) mouse HEPA1-6 and 3) human HeLa lysate with CD5 antibody at 0.5ug/ml. Observed molecular weight: 55~67 kDa depending on glycosylation level.
2 / 2
Flow cytometry testing of human PBMC with CD5 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=CD5 antibody.
❮❯

Western blot testing of 1) rat liver, 2) mouse HEPA1-6 and 3) human HeLa lysate with CD5 antibody at 0.5ug/ml. Observed molecular weight: 55~67 kDa depending on glycosylation level.
Flow cytometry testing of human PBMC with CD5 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=CD5 antibody.

Documents

Further Information

Application Details :
Western Blot: 0.5-1ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the CD5 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
CD5 is a member of the scavenger receptor cysteine-rich (SRCR) superfamily. Members of this family are secreted or membrane-anchored proteins mainly found in cells associated with the immune system. In humans, the gene is located on the long arm of chromosome 11. This protein is a type-I transmembrane glycoprotein found on the surface of thymocytes, T lymphocytes and a subset of B lymphocytes. The encoded protein contains three SRCR domains and may act as a receptor to regulate T-cell proliferation. Alternative splicing results in multiple transcript variants encoding different isoforms.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids KKLVKKFRQKKQRQWIGPTGMNQNMSFHRNHTATVRSH from the human protein were used as the immunogen for the CD5 antibody.
Limitation:
This CD5 antibody is available for research use only.
Purity:
Antigen affinity purified
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
P06127