Cdc20 Antibody

Contact us
NSJ Bioreagents
Product Code: NSJ-R32832
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-R32832-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
After reconstitution, the Cdc20 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 9
Western blot testing of human HeLa cell lysate with Cdc20 antibody at 0.5ug/ml. Predicted molecular weight ~55 kDa.
2 / 9
IHC testing of FFPE human colon cancer tissue with Cdc20 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
3 / 9
IHC testing of FFPE human breast cancer tissue with Cdc20 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
4 / 9
IHC testing of FFPE human lung cancer tissue with Cdc20 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
5 / 9
IHC testing of FFPE mouse small intestine tissue with Cdc20 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
6 / 9
IHC testing of FFPE rat small intestine tissue with Cdc20 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
7 / 9
Immunofluorescent staining of FFPE mouse NIH3T3 cells with Cdc20 antibody (green) at 2ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.
8 / 9
Flow cytometry testing of human U-2 OS cells with Cdc20 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= Cdc20 antibody.
9 / 9
Flow cytometry testing of human SiHa cells with Cdc20 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= Cdc20 antibody.
❮❯

Western blot testing of human HeLa cell lysate with Cdc20 antibody at 0.5ug/ml. Predicted molecular weight ~55 kDa.
IHC testing of FFPE human colon cancer tissue with Cdc20 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
IHC testing of FFPE human breast cancer tissue with Cdc20 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
IHC testing of FFPE human lung cancer tissue with Cdc20 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
IHC testing of FFPE mouse small intestine tissue with Cdc20 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
IHC testing of FFPE rat small intestine tissue with Cdc20 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
Immunofluorescent staining of FFPE mouse NIH3T3 cells with Cdc20 antibody (green) at 2ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.
Flow cytometry testing of human U-2 OS cells with Cdc20 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= Cdc20 antibody.
Flow cytometry testing of human SiHa cells with Cdc20 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= Cdc20 antibody.

Documents

Further Information

Application Details :
Western Blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml,Immunofluorescence (FFPE): 2-4ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the Cdc20 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
Description:
The cell-division cycle protein 20, also known as p55CDC, is an essential regulator of cell division that is encoded by the CDC20 gene in humans. The chromosomal assignment of human CDC20 is 1p34.2. CDC20 is a component of the mammalian cell cycle mechanism. CDC20 appears to act as a regulatory protein interacting with many other proteins at multiple points in the cell cycle. This gene?s most important function is to activate the anaphase promoting complex (APC), a large 11-13 subunit complex that initiates chromatid separation and entrance into anaphase.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids QTPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKAT were used as the immunogen for the Cdc20 antibody.
Limitation:
This Cdc20 antibody is available for research use only.
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
Q12834