CDC25C Antibody
Code | Size | Price |
---|
NSJ-R32057-100ug | 100 ug | £535.00 |
Quantity:
Prices exclude any Taxes / VAT
Overview
Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species: Human
Application: Western Blot (WB)
Storage:
After reconstitution, the CDC25C antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
Images
Documents
Further Information
Application Details :
Western blot: 0.1-0.5ug/ml
Application Note:
Optimal dilution of the CDC25C antibody should be determined by the researcher.
Description:
M-phase inducer phosphatase 3is anenzymethat in humans is encoded by the CDC25C gene. This gene is highly conserved during evolution and it plays a key role in the regulation of cell division. The encoded protein is a tyrosine phosphatase and belongs to the Cdc25 phosphatase family. It directs dephosphorylation of cyclin B-bound CDC2 (CDK1) and triggers entry into mitosis. Also, it is thought to suppress p53-induced growth arrest. Multiple alternatively spliced transcript variants of this gene have been described, however, the full-length nature of many of them is not known.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids MHHQDHKTELLRCRSQSKVQEGERQLREQIALLVKDMSP of human CDC25C were used as the immunogen for the CDC25C antibody.
Limitation:
This CDC25C antibody is available for research use only.
Purity:
Antigen affinity
Species Reactivity :
Human
Uniprot #:
P30307