CEP68 Antibody

NSJ Bioreagents
Product Code: NSJ-RQ4329
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-RQ4329-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Application: Western Blot (WB)
Storage:
After reconstitution, the CEP68 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 1
Western blot testing of human 1) HeLa, 2) COLO-320, 3) SK-O-V3, 4) Jurkat, 5) rat heart and 6) mouse heart lysate with CEP68 antibody at 0.5ug/ml. Predicted molecular weight ~81 kDa (isoform 1), ~67 kDa (isoform 2).

Western blot testing of human 1) HeLa, 2) COLO-320, 3) SK-O-V3, 4) Jurkat, 5) rat heart and 6) mouse heart lysate with CEP68 antibody at 0.5ug/ml. Predicted molecular weight ~81 kDa (isoform 1), ~67 kDa (isoform 2).

Further Information

Application Details :
Western blot: 0.5-1ug/ml
Application Note:
Optimal dilution of the CEP68 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
Centrosomal protein of 68 kDa is a protein that in humans is encoded by the CEP68 gene. It is mapped to chromosome 2. CEP68 is required for centrosome cohesion. It decorates fibres emanating from the proximal ends of centrioles. CEP68 and Rootletin depend both on each other for centriole association, and both also require CEP250 for their function.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids ELICWLYNVADVTDHGTAARSNLTSLKSSLQLYRQFKKDID were used as the immunogen for the CEP68 antibody.
Limitation:
This CEP68 antibody is available for research use only.
Localization:
Cytoplasm, cytoskeleton
Purity:
Antigen affinity purified
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
Q76N32