CHRNA3 Antibody

Contact us
NSJ Bioreagents
Product Code: NSJ-RQ4415
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-RQ4415-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Fluorescence-activated cell sorting (FACS)
  • Western Blot (WB)
Storage:
After reconstitution, the CHRNA3 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 3
Western blot testing of human 1) HeLa, 2) MDA-MB-453, 3) Jurkat, 4) HepG2, 5) SK-OV-3, 6) PANC-1 and 7) mouse thymus lysate with CHRNA3 antibody at 0.5ug/ml. Predicted molecular weight ~57 kDa.
2 / 3
Flow cytometry testing of human U-251 MG cells with CHRNA3 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=CHRNA3 antibody.
3 / 3
Flow cytometry testing of human U-87 MG cells with CHRNA3 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=CHRNA3 antibody.
❮❯

Western blot testing of human 1) HeLa, 2) MDA-MB-453, 3) Jurkat, 4) HepG2, 5) SK-OV-3, 6) PANC-1 and 7) mouse thymus lysate with CHRNA3 antibody at 0.5ug/ml. Predicted molecular weight ~57 kDa.
Flow cytometry testing of human U-251 MG cells with CHRNA3 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=CHRNA3 antibody.
Flow cytometry testing of human U-87 MG cells with CHRNA3 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=CHRNA3 antibody.

Documents

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the CHRNA3 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
After binding acetylcholine, Nicotinic Acetylcholine Receptor alpha 3 (CHRNA3) responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. [UniProt]
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids DAVLSLSALSPEIKEAIQSVKYIAENMKAQNEAKEIQD from the human protein were used as the immunogen for the CHRNA3 antibody.
Limitation:
This CHRNA3 antibody is available for research use only.
Purity:
Antigen affinity purified
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
P32297