DHODH Antibody

Contact us
NSJ Bioreagents
Product Code: NSJ-R32524
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-R32524-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
After reconstitution, the DHODH antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 4
Western blot testing of 1) rat liver, 2) mouse spleen and 3) human HepG2 lysate with DHODH antibody at 0.5ug/ml. Predicted/observed molecular weight ~43 kDa.
2 / 4
IHC testing of FFPE human lung cancer tissue with DHODH antibody at 1ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.
3 / 4
IHC testing of FFPE mouse intestine with DHODH antibody at 1ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.
4 / 4
IHC testing of FFPE rat intestine with DHODH antibody at 1ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.
❮❯

Western blot testing of 1) rat liver, 2) mouse spleen and 3) human HepG2 lysate with DHODH antibody at 0.5ug/ml. Predicted/observed molecular weight ~43 kDa.
IHC testing of FFPE human lung cancer tissue with DHODH antibody at 1ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.
IHC testing of FFPE mouse intestine with DHODH antibody at 1ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.
IHC testing of FFPE rat intestine with DHODH antibody at 1ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.

Documents

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml
Buffer:
Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
Description:
Dihydroorotate dehydrogenase is an enzyme that in humans is encoded by the DHODH gene on chromosome 16. The protein encoded by this gene catalyzes the fourth enzymatic step, the ubiquinone-mediated oxidation of dihydroorotate to orotate, in de novo pyrimidine biosynthesis. This protein is a mitochondrial protein located on the outer surface of the inner mitochondrial membrane.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids 132-173 (RVFRLPEDQAVINRYGFNSHGLSVVEHRLRARQQKQAKLTED) from the human protein were used as the immunogen for the DHODH antibody.
Limitation:
This DHODH antibody is available for research use only.
Localization:
Cytoplasmic
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
Q02127