Dishevelled Antibody / DVL1

NSJ Bioreagents
Product Code: NSJ-R32636
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-R32636-100ug100ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Human
  • Rat
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
After reconstitution, the DVL1 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 2
Western blot testing of rat 1) brain and 2) testis lysate with DVL1 antibody at 0.5ug/ml. Predicted molecular weight ~75 kDa.~
2 / 2
IHC testing of FFPE human lung cancer tissue with DVL1 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate b

Western blot testing of rat 1) brain and 2) testis lysate with DVL1 antibody at 0.5ug/ml. Predicted molecular weight ~75 kDa.~
IHC testing of FFPE human lung cancer tissue with DVL1 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate b

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml
Application Note:
Optimal dilution of the DVL1 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
Description:
Segment polarity protein dishevelled homolog DVL-1 is a protein that in humans is encoded by the DVL1 gene. DVL1, the human homolog of the Drosophila dishevelled gene (dsh) encodes a cytoplasmic phosphoprotein that regulates cell proliferation, acting as a transducer molecule for developmental processes, including segmentation and neuroblast specification. DVL1 is a candidate gene for neuroblastomatous transformation. The Schwartz-Jampel syndrome and Charcot-Marie-Tooth disease type 2A have been mapped to the same region as DVL1. The phenotypes of these diseases may be consistent with defects which might be expected from aberrant expression of a DVL gene during development.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids 401-438 (APQLEEAPLTVKSDMSAVVRVMQLPDSGLEIRDRMWLK) from the human protein were used as the immunogen for the DVL1 antibody.
Limitation:
This DVL1 antibody is available for research use only.
Localization:
Cytoplasmic
Purity:
Antigen affinity
Species Reactivity :
Human, Rat
Uniprot #:
O14640