EGF Receptor / EGFR Antibody (N-Terminal Region)

Contact us
NSJ Bioreagents
Product Code: NSJ-R32810
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-R32810-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Application: Western Blot (WB)
Storage:
After reconstitution, the EGFR antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 4
Western blot testing of human A431 cell lysate with EGFR antibody at 0.5ug/ml. Expected molecular weight: ~134 kDa (unmodified), ~170 kDa (glycosylated).
2 / 4
IHC staining of FFPE human placenta with EGFR antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
3 / 4
IHC staining of FFPE human glioma with EGFR antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
4 / 4
Flow cytometry testing of human A431 cells with EGFR antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= EGFR antibody.
❮❯

Western blot testing of human A431 cell lysate with EGFR antibody at 0.5ug/ml. Expected molecular weight: ~134 kDa (unmodified), ~170 kDa (glycosylated).
IHC staining of FFPE human placenta with EGFR antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
IHC staining of FFPE human glioma with EGFR antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
Flow cytometry testing of human A431 cells with EGFR antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= EGFR antibody.

Documents

Further Information

Application Details :
Western Blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the EGFR antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
Description:
The epidermal growth factor receptor (EGFR; ErbB-1; HER1 in humans) is the cell-surface receptor for members of the epidermal growth factor family (EGF-family) of extracellular protein ligands. It is a member of the ErbB family of receptors, a subfamily of four closely related receptor tyrosine kinases: EGFR (ErbB-1), HER2/c-neu (ErbB-2), Her 3 (ErbB-3) and Her 4 (ErbB-4). EGFR exists on the cell surface and is activated by binding of its specific ligands, including epidermal growth factor and transforming growth factor ? (TGF?). EGFR and its ligands are cell signaling molecules involved in diverse cellular functions, including cell proliferation, differentiation, motility, and survival, and in tissue development. Mutations that lead to EGFR overexpression (known as upregulation) or overactivity have been associated with a number of cancers, including lung cancer and glioblastoma multiforme. In this latter case a more or less specific mutation of EGFR, called EGFRvIII is often observed.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids 25-57 (LEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNN) were used as the immunogen for the EGFR antibody.
Limitation:
This EGFR antibody is available for research use only.
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
P00533