ELF1 Antibody / E74 like factor 1

Contact us
NSJ Bioreagents
Product Code: NSJ-RQ4212
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-RQ4212-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species: Human
Application: Western Blot (WB)
Storage:
After reconstitution, the Elf-1 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 1
Western blot testing of human 1) HeLa, 2) COLO320, 3) A549, 4) PANC-1, 5) A431, 6) Jurkat and 7) 293T cell lysate with Elf-1 antibody at 0.5ug/ml. Expected molecular weight: ~68 kDa (unmodified) up to ~80 kDa (phosphorylated/glycosylated cytoplasmic form) and up to ~98 kDa (phosphorylated/glycosylated nuclear form).
❮❯

Western blot testing of human 1) HeLa, 2) COLO320, 3) A549, 4) PANC-1, 5) A431, 6) Jurkat and 7) 293T cell lysate with Elf-1 antibody at 0.5ug/ml. Expected molecular weight: ~68 kDa (unmodified) up to ~80 kDa (phosphorylated/glycosylated cytoplasmic form) and up to ~98 kDa (phosphorylated/glycosylated nuclear form).

Documents

Further Information

Application Details :
Western Blot: 0.5-1ug/ml
Application Note:
Optimal dilution of the Elf-1 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
E74-like factor 1 (ets domain transcription factor) is a protein that in humans is encoded by the ELF1 gene. It is mapped to chromosome 13q13. This gene encodes an E26 transformation-specific related transcription factor. The encoded protein is primarily expressed in lymphoid cells and acts as both an enhancer and a repressor to regulate transcription of various genes. Alternative splicing results in multiple transcript variants.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids QPTQSPYPTQLFRTVHVVQPVQAVPEGEAARTSTMQDE were used as the immunogen for the Elf-1 antibody.
Limitation:
This Elf-1 antibody is available for research use only.
Localization:
Nuclear, cytoplasmic
Purity:
Antigen affinity purified
Species Reactivity :
Human
Species Reactivity (Predicted):
Mouse, Rat
Uniprot #:
P32519