EpCAM Antibody

Contact us
NSJ Bioreagents
Product Code: NSJ-R32527
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-R32527-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species: Human
Applications:
  • Enzyme-Linked Immunosorbent Assay (ELISA)
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
After reconstitution, the EpCAM antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 3
IHC testing of FFPE human prostate cancer tissue with EpCAM antibody at 1ug/ml. HIER: steam sections in pH6 citrate buffer for 20 min.
2 / 3
IHC testing of FFPE human intestinal cancer tissue with EpCAM antibody at 1ug/ml. HIER: steam sections in pH6 citrate buffer for 20 min.
3 / 3
Western blot testing of human 1) HeLa, 2) A549 and 3) PANC-1 lysate with EpCAM antibody at 0.5ug/ml. Expected molecualr weight: 35/40-42 kDa (unmodified/glycosylated).
❮❯

IHC testing of FFPE human prostate cancer tissue with EpCAM antibody at 1ug/ml. HIER: steam sections in pH6 citrate buffer for 20 min.
IHC testing of FFPE human intestinal cancer tissue with EpCAM antibody at 1ug/ml. HIER: steam sections in pH6 citrate buffer for 20 min.
Western blot testing of human 1) HeLa, 2) A549 and 3) PANC-1 lysate with EpCAM antibody at 0.5ug/ml. Expected molecualr weight: 35/40-42 kDa (unmodified/glycosylated).

Documents

Further Information

Application Details :
Western blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml,ELISA: 0.5-1ug/ml (human protein tested); request BSA-free format for coating
Buffer:
Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
Description:
Epithelial cell adhesion molecule (EpCAM) is a transmembrane glycoprotein mediating Ca2+-independent homotypic cell?cell adhesion in epithelia. This gene encodes a carcinoma-associated antigen and is a member of a family that includes at least two type I membrane proteins. This antigen is expressed on most normal epithelial cells and gastrointestinal carcinomas and functions as a homotypic calcium-independent cell adhesion molecule. The antigen is being used as a target for immunotherapy treatment of human carcinomas. Mutations in this gene result in congenital tufting enteropathy.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids 147-189 (ELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENN) from the human protein were used as the immunogen for the EpCAM antibody.
Limitation:
This EpCAM antibody is available for research use only.
Localization:
Cell surface, cytoplasmic
Purity:
Antigen affinity
Species Reactivity :
Human
Uniprot #:
P16422