ERBB4 Antibody / HER4

Contact us
NSJ Bioreagents
Product Code: NSJ-RQ4013
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-RQ4013-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
After reconstitution, the ERBB4 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 5
IHC testing of FFPE human breast cancer tissue with ERBB4 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
2 / 5
IHC testing of FFPE human colon cancer tissue with ERBB4 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
3 / 5
IHC testing of FFPE mouse brain tissue with ERBB4 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
4 / 5
IHC testing of FFPE rat brain tissue with ERBB4 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
5 / 5
Western blot testing of 1) human PANC-1, 2) human placenta, 3) rat kidney and 4) mouse kidney lysate with ERBB4 antibody at 0.5ug/ml. Predicted molecular weight: 147-180 kDa (precursor), 120, 80 kDa (cleaved forms).
❮❯

IHC testing of FFPE human breast cancer tissue with ERBB4 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
IHC testing of FFPE human colon cancer tissue with ERBB4 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
IHC testing of FFPE mouse brain tissue with ERBB4 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
IHC testing of FFPE rat brain tissue with ERBB4 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
Western blot testing of 1) human PANC-1, 2) human placenta, 3) rat kidney and 4) mouse kidney lysate with ERBB4 antibody at 0.5ug/ml. Predicted molecular weight: 147-180 kDa (precursor), 120, 80 kDa (cleaved forms).

Documents

Further Information

Application Details :
Western Blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml
Application Note:
Optimal dilution of the ERBB4 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
ERBB4 (V-erb-b2 avian erythroblastic leukemia viral oncogene homolog 4) also known as ONCOGENE ERBB4 or HER4, is an enzyme that in humans is encoded by the ERBB4 gene. The HER4/ERBB4 gene is a member of the type I receptor tyrosine kinase subfamily that includes EGFR, ERBB2 and ERBB3. This gene is mapped on 2q34. ERBB4 is a single-pass type I transmembrane protein with multiple furin-like cysteine rich domains, a tyrosine kinase domain, a phosphotidylinositol-3 kinase binding site and a PDZ domainbinding motif. Furthermore, ERBB4 is a transmembrane receptor tyrosine kinase that regulates cell proliferation and differentiation. After binding its ligand, heregulin, or activation of protein kinase C by TPA, the ERBB4 ectodomain is cleaved by a metalloprotease.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids SLSDLEQQYRALRKYYENCEVVMGNLEITSIEHNRDLSFLR from the human protein were used as the immunogen for the ERBB4 antibody.
Limitation:
This ERBB4 antibody is available for research use only.
Localization:
Cytoplasmic, nuclear
Purity:
Antigen affinity purified
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
Q15303