ETS1 Antibody
Code | Size | Price |
---|
NSJ-R32685-100ug | 100ug | £535.00 |
Quantity:
Prices exclude any Taxes / VAT
Overview
Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
- Human
- Mouse
Application: Western Blot (WB)
Storage:
After reconstitution, the ETS1 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.
Images
Documents
Further Information
Application Details :
Western blot: 0.5-1ug/ml
Application Note:
Optimal dilution of the ETS1 antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
Description:
Protein C-ets-1 is a protein that in humans is encoded by the ETS1 gene. It is mapped to 11q24.3. This gene encodes a member of the ETS family of transcription factors, which are defined by the presence of a conserved ETS DNA-binding domain that recognizes the core consensus DNA sequence GGAA/T in target genes. These proteins function either as transcriptional activators or repressors of numerous genes, and are involved in stem cell development, cell senescence and death, and tumorigenesis.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids 67-98 (KDPRQWTETHVRDWVMWAVNEFSLKGVDFQKF) from the human protein were used as the immunogen for the ETS1 antibody.
Limitation:
This ETS1 antibody is available for research use only.
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse
Uniprot #:
P14921