EWS Antibody / EWSR1

Contact us
NSJ Bioreagents
Product Code: NSJ-R32181
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-R32181-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
After reconstitution, the EWSR1 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 10
ICC staining of FFPE human SMMC-7721 cells with EWSR1 antibody at 1ug/ml. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
2 / 10
IHC testing of FFPE human breast cancer tissue with EWSR1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
3 / 10
IHC testing of FFPE mouse testis with EWSR1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
4 / 10
IHC testing of FFPE rat testis with EWSR1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
5 / 10
IHC staining of frozen human placental tissue with EWSR1 antibody at 1ug/ml.
6 / 10
IHC staining of frozen mouse intestinal tissue with EWSR1 antibody at 1ug/ml.
7 / 10
IHC staining of frozen rat intestinal tissue with EWSR1 antibody at 1ug/ml.
8 / 10
Immunofluorescent staining of FFPE human U-2 OS cells with EWSR1 antibody (green) at 2ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.
9 / 10
Western blot testing of human 1) HeLa, 2) K562, 3) Jurkat, 4) HL60 and 5) HEK293 cell lysate with EWSR1 antibody. Predicted molecular weight: ~69 kDa, but routinely observed at ~90 kDa.
10 / 10
Flow cytometry testing of human U-2 OS cells with EWSR1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= EWSR1 antibody.
❮❯

ICC staining of FFPE human SMMC-7721 cells with EWSR1 antibody at 1ug/ml. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE human breast cancer tissue with EWSR1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE mouse testis with EWSR1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE rat testis with EWSR1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC staining of frozen human placental tissue with EWSR1 antibody at 1ug/ml.
IHC staining of frozen mouse intestinal tissue with EWSR1 antibody at 1ug/ml.
IHC staining of frozen rat intestinal tissue with EWSR1 antibody at 1ug/ml.
Immunofluorescent staining of FFPE human U-2 OS cells with EWSR1 antibody (green) at 2ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.
Western blot testing of human 1) HeLa, 2) K562, 3) Jurkat, 4) HL60 and 5) HEK293 cell lysate with EWSR1 antibody. Predicted molecular weight: ~69 kDa, but routinely observed at ~90 kDa.
Flow cytometry testing of human U-2 OS cells with EWSR1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= EWSR1 antibody.

Documents

Further Information

Application Details :
Western blot: 0.1-0.5ug/ml,Immunohistochemistry (Paraffin): 0.5-1ug/ml,Immunohistochemistry (Frozen): 1-2ug/ml,Immunocytochemistry (FFPE): 1-2ug/ml,Immunofluorescence: 2-4ug/ml,Flow ctyometry: 1-3ug/million cells
Application Note:
Optimal dilution of the EWSR1 antibody should be determined by the researcher.
Description:
This gene encodes a multifunctional protein that is involved in various cellular processes, including gene expression, cell signaling, and RNA processing and transport. The protein includes an N-terminal transcriptional activation domain and a C-terminal RNA-binding domain. Chromosomal translocations between this gene and various genes encoding transcription factors result in the production of chimeric proteins that are involved in tumorigenesis. These chimeric proteins usually consist of the N-terminal transcriptional activation domain of this protein fused to the C-terminal DNA-binding domain of the transcription factor protein. Mutations in this gene, specifically a t(11;22)(q24;q12) translocation, are known to cause Ewing sarcoma as well as neuroectodermal and various other tumors. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 1 and 14.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids NDSVTLDDLADFFKQCGVVKMNKRTGQPMIH of human EWSR1 were used as the immunogen for the EWSR1 antibody.
Limitation:
This EWSR1 antibody is available for research use only.
Localization:
Nuclear
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
Q01844