FE65 Antibody

Contact us
NSJ Bioreagents
Product Code: NSJ-R31784
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-R31784-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
After reconstitution, the FE65 antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 4
Western blot testing of 1) rat brain, 2) mouse brain, 3) human HeLa and 4) U87 lysate with FE65 antibody. Predicted molecular weight: ~77 kDa; the 97 kDa isoform can be cleaved to yield a 65 kDa C-terminal form.
2 / 4
IHC testing of FFPE human glioma tissue with FE65 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
3 / 4
IHC testing of FFPE mouse brain with FE65 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
4 / 4
IHC testing of FFPE rat brain with FE65 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
❮❯

Western blot testing of 1) rat brain, 2) mouse brain, 3) human HeLa and 4) U87 lysate with FE65 antibody. Predicted molecular weight: ~77 kDa; the 97 kDa isoform can be cleaved to yield a 65 kDa C-terminal form.
IHC testing of FFPE human glioma tissue with FE65 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE mouse brain with FE65 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE rat brain with FE65 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.

Documents

Further Information

Application Details :
Western blot: 0.1-0.5ug/ml,Immunohistochemistry (FFPE): 0.5-1ug/ml
Application Note:
Optimal dilution of the FE65 antibody should be determined by the researcher.
Description:
APBB1/RIR/FE65 is a transcription coregulator that can have both coactivator and corepressor functions. Adapter protein that forms a transcriptionally active complex with the gamma-secretase-derived amyloid precursor protein (APP) intracellular domain. Plays a central role in the response to DNA damage by translocating to the nucleus and inducing apoptosis. May act by specifically recognizing and binding histone H2AX phosphorylated on 'Tyr-142' (H2AXY142ph) at double-strand breaks (DSBs), recruiting other pro-apoptosis factors such as MAPK8/JNK1. Required for histone H4 acetylation at double-strand breaks (DSBs). Its ability to specifically bind modified histones and chromatin modifying enzymes such as KAT5/TIP60, probably explains its trancription activation activity. Function in association with TSHZ3, SET and HDAC factors as a transcriptional repressor, that inhibits the expression of CASP4. Associates with chromatin in a region surrounding the CASP4 transcriptional start site(s). encoding different isoforms have been described for this gene.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids ALSLPLPLHAAHNQLLNAKLQATAVGPKDLRSAMGE of human FE65 were used as the immunogen for the FE65 antibody.
Limitation:
This FE65 antibody is available for research use only.
Localization:
Cytoplasmic, membrane
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
O00213