FH Antibody / Fumarate hydratase

Contact us
NSJ Bioreagents
Product Code: NSJ-R32920
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-R32920-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Applications:
  • Immunohistochemistry- Paraffin Embedded (IHC-P)
  • Western Blot (WB)
Storage:
After reconstitution, the FH antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 8
Western blot testing of 1) rat lymph, 2) rat small intestine, 3) rat stomach, 4) mouse kidney, 5) mouse testis, 6) mouse stomach, 7) human K562, 8) human U937 and 9) human HL60 lysate with FH antibody at 0.5ug/ml. Predicted molecular weight: ~55/50kDa (isoforms 1/2).
2 / 8
IHC testing of FFPE human colon cancer tissue with FH antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
3 / 8
IHC testing of FFPE human lung cancer tissue with FH antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
4 / 8
IHC testing of FFPE human breast cancer tissue with FH antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
5 / 8
IHC testing of FFPE human placenta tissue with FH antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
6 / 8
IHC testing of FFPE mouse small intestine tissue with FH antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
7 / 8
Flow cytometry testing of human A431 cells with FH antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= FH antibody.
8 / 8
Flow cytometry testing of human PC-3 cells with FH antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= FH antibody.
❮❯

Western blot testing of 1) rat lymph, 2) rat small intestine, 3) rat stomach, 4) mouse kidney, 5) mouse testis, 6) mouse stomach, 7) human K562, 8) human U937 and 9) human HL60 lysate with FH antibody at 0.5ug/ml. Predicted molecular weight: ~55/50kDa (isoforms 1/2).
IHC testing of FFPE human colon cancer tissue with FH antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
IHC testing of FFPE human lung cancer tissue with FH antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
IHC testing of FFPE human breast cancer tissue with FH antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
IHC testing of FFPE human placenta tissue with FH antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
IHC testing of FFPE mouse small intestine tissue with FH antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
Flow cytometry testing of human A431 cells with FH antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= FH antibody.
Flow cytometry testing of human PC-3 cells with FH antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= FH antibody.

Documents

Further Information

Application Details :
Western Blot: 0.5-1ug/ml,Immunohistochemistry (FFPE): 1-2ug/ml,Flow cytometry: 1-3ug/million cells
Application Note:
Optimal dilution of the FH antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
Description:
Fumarase (or Fumarate hydratase) is an enzyme that catalyzes the reversible hydration/dehydration of fumarate to malate. Fumarase comes in two forms: mitochondrial and cytosolic. The mitochondrial isoenzyme is involved in the Krebs Cycle (also known as the Tricarboxylic Acid Cycle [TCA] or the Citric Acid Cycle), and the cytosolic isoenzyme is involved in the metabolism of amino acids and fumarate. Subcellular localization is established by the presence of a signal sequence on the amino terminus in the mitochondrial form, while subcellular localization in the cytosolic form is established by the absence of the signal sequence found in the mitochondrial variety. This enzyme participates in 2 metabolic pathways: citric acid cycle, reductive citric acid cycle (CO2 fixation), and is also important in renal cell carcinoma. Mutations in this gene have been associated with the development of leiomyomas in the skin and uterus in combination with renal cell carcinoma.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids YDKAAKIAKTAHKNGSTLKETAIELGYLTAEQFDEWVKPKDMLGPK were used as the immunogen for the FH antibody.
Limitation:
This FH antibody is available for research use only.
Localization:
Cytoplasmic
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
P07954