FMRP Antibody / FMR1

Contact us
NSJ Bioreagents
Product Code: NSJ-R32195
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-R32195-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Application: Western Blot (WB)
Storage:
After reconstitution, the FMRP antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 3
IHC staining of FFPE human testicular seminoma tissue with FRMP antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
2 / 3
Immunofluorescent staining of FFPE human HeLa cells with FMRP antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
3 / 3
Western blot testing of 1) human HeLa, 2) human 293T, 3) human Jurkat, 4) human K5632, 5) rat brain, 6) rat liver, 7) mouse brain and 8) mouse liver lysate with FMRP antibody. Predicted molecular weight ~71 kDa with multiple isoforms observed at 67-90 kDa.
❮❯

IHC staining of FFPE human testicular seminoma tissue with FRMP antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
Immunofluorescent staining of FFPE human HeLa cells with FMRP antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
Western blot testing of 1) human HeLa, 2) human 293T, 3) human Jurkat, 4) human K5632, 5) rat brain, 6) rat liver, 7) mouse brain and 8) mouse liver lysate with FMRP antibody. Predicted molecular weight ~71 kDa with multiple isoforms observed at 67-90 kDa.

Documents

Further Information

Application Details :
Western blot: 0.1-0.5ug/ml
Application Note:
Optimal dilution of the FMRP antibody should be determined by the researcher.
Description:
FMR1 (fragile X mental retardation 1) is a human gene that codes for a protein called fragile X mental retardation protein, or FMRP. This protein, most commonly found in the brain, is essential for normalcognitive developmentand female reproductive function. Mutations of this gene can lead to fragile X syndrome, mental retardation, premature ovarian failure, autism, Parkinson's disease, developmental delays and other cognitive deficits. The protein encoded by this gene binds RNA and is associated with polysomes. Additionally, the encoded protein may be involved in mRNA trafficking from the nucleus to the cytoplasm. A trinucleotide repeat (CGG) in the 5' UTR is normally found at 6-53 copies, but an expansion to 55-230 repeats is the cause of fragile X syndrome. Expansion of the trinucleotide repeat may also cause one form of premature ovarian failure (POF1). Multiple alternatively spliced transcript variants that encode different protein isoforms and which are located in different cellular locations have been described for this gene.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids ENYQLVILSINEVTSKRAHMLIDMHFRSLRTKLSLIM of human FMRP were used as the immunogen for the FMRP antibody.
Limitation:
This FMRP antibody is available for research use only.
Purity:
Antigen affinity
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
Q06787