GADD45G Antibody

Contact us
NSJ Bioreagents
Product Code: NSJ-RQ4429
Product Group: Primary Antibodies
Supplier: NSJ Bioreagents
CodeSizePrice
NSJ-RQ4429-100ug100 ug£535.00
Quantity:
Prices exclude any Taxes / VAT

Overview

Host Type: Rabbit
Antibody Isotype: Rabbit IgG
Antibody Clonality: Polyclonal
Regulatory Status: RUO
Target Species:
  • Human
  • Mouse
  • Rat
Application: Western Blot (WB)
Storage:
After reconstitution, the GADD45G antibody can be stored for up to one month at 40. For long-term, aliquot and store at -200. Avoid repeated freezing and thawing.

Images

1 / 2
Western blot testing of human 1) HeLa, 2) placenta, 3) SW620, 4) A549 and 5) mouse NIH 3T3 lysate with GADD45G antibody at 0.5ug/ml. Predicted molecular weight ~17 kDa.
2 / 2
Western blot testing of 1) rat brain, 2) rat heart, 3) rat testis, 4) rat skeletal muscle, 5) mouse brain, 6) mouse heart, 7) mouse testis and 8) mouse skeletal muscle lysate with GADD45G antibody at 0.5ug/ml. Predicted molecular weight ~17 kDa.
❮❯

Western blot testing of human 1) HeLa, 2) placenta, 3) SW620, 4) A549 and 5) mouse NIH 3T3 lysate with GADD45G antibody at 0.5ug/ml. Predicted molecular weight ~17 kDa.
Western blot testing of 1) rat brain, 2) rat heart, 3) rat testis, 4) rat skeletal muscle, 5) mouse brain, 6) mouse heart, 7) mouse testis and 8) mouse skeletal muscle lysate with GADD45G antibody at 0.5ug/ml. Predicted molecular weight ~17 kDa.

Documents

Further Information

Application Details :
Western blot: 0.5-1ug/ml
Application Note:
Optimal dilution of the GADD45G antibody should be determined by the researcher.
Buffer:
Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
Description:
Growth arrest and DNA-damage-inducible protein GADD45 gamma is a protein that in humans is encoded by the GADD45G gene on chromosome 9. This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The protein encoded by this gene responds to environmental stresses by mediating activation of the p38/JNK pathway via MTK1/MEKK4 kinase. The GADD45G is highly expressed in placenta.
Format :
Antigen affinity purified
Formulation :
0.5mg/ml if reconstituted with 0.2ml sterile DI water
Immunogen:
Amino acids MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQ from the human protein were used as the immunogen for the GADD45G antibody.
Limitation:
This GADD45G antibody is available for research use only.
Purity:
Antigen affinity purified
Species Reactivity :
Human, Mouse, Rat
Uniprot #:
O95257